BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j17 (597 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364549-1|AAK52057.1| 454|Drosophila melanogaster gag protein ... 29 6.3 AE014296-2536|AAF49616.1| 2139|Drosophila melanogaster CG6498-PA... 29 6.3 >AF364549-1|AAK52057.1| 454|Drosophila melanogaster gag protein protein. Length = 454 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 240 GPVRTNQVTPLVTEIVPSLQFGDISVTGDMPIGGTIKVSGCFP 368 G V Q+ P E P + + +TG +P G T+ C P Sbjct: 81 GQVAAIQIAPARAEAPPIKVYRPVEITGLVPCGETLDAVKCLP 123 >AE014296-2536|AAF49616.1| 2139|Drosophila melanogaster CG6498-PA protein. Length = 2139 Score = 28.7 bits (61), Expect = 6.3 Identities = 21/77 (27%), Positives = 29/77 (37%) Frame = -3 Query: 439 PPPVFMTALPEDGMLPSTATVP*TGKQPLTFIVPPIGMSPVTEMSPNCREGTISVTRGVT 260 PPP + LP G + + G P V P G+ P P+ G T Sbjct: 1729 PPPTQLVLLPHVGAVVGSNPTS-VGNVP----VSPTGVVPQLYQRPSTLHGLKHKLHAAT 1783 Query: 259 WLVRTGP*SGNPVAGLK 209 ++ G + NP GLK Sbjct: 1784 AVIAGGGNANNPAGGLK 1800 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,362,307 Number of Sequences: 53049 Number of extensions: 754731 Number of successful extensions: 2234 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2233 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2420893683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -