BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j15 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 1.6 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 6.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.8 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 433 EKGSFFWNTPFKLEGNKYKLLFTY 362 +KG FW +PF + + + TY Sbjct: 390 DKGDIFWFSPFLVANLAFVTIVTY 413 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 314 MLAKAQILYHIQCIKPGNSFGPYS 243 +L+ + L+H +C KP + P S Sbjct: 25 VLSSDEELFHQKCPKPAPIYSPVS 48 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 3 LIKLIHKYNPTVFL 44 ++ +HKY PTV L Sbjct: 145 MLNSLHKYKPTVHL 158 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 8.8 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 366 VNNNLYLLPSSLKGVFQKNEPFSKPLIYALYHDLKKPHKQLKDDSIYNFV 515 +N+N L K + +SK + L +K L DS+Y+F+ Sbjct: 325 LNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLADLYKSLGPDSVYSFI 374 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 8.8 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 366 VNNNLYLLPSSLKGVFQKNEPFSKPLIYALYHDLKKPHKQLKDDSIYNFV 515 +N+N L K + +SK + L +K L DS+Y+F+ Sbjct: 217 LNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLADLYKSLGPDSVYSFI 266 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,375 Number of Sequences: 336 Number of extensions: 2916 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -