BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j15 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 1.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 3.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 3.4 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 411 FQKNEPFSKPLIYA-LYHD--LKKPHKQLKDDSIYNFVERRF 527 F KN P YA L ++ P KQL + IYN+ + F Sbjct: 497 FYKNADVRPPFTYASLIRQSIIESPDKQLTLNEIYNWFQNTF 538 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 586 SPAQMPQIIGEIA*SAISFPNLLSTKL 506 +P ++P IGE++ + FP L T+L Sbjct: 65 APQKIPAWIGELSATKFGFPCLQYTQL 91 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 586 SPAQMPQIIGEIA*SAISFPNLLSTKL 506 +P ++P IGE++ + FP L T+L Sbjct: 65 APQKIPAWIGELSATKFGFPCLQYTQL 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,609 Number of Sequences: 438 Number of extensions: 3170 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -