BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j14 (671 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12650.1 68414.m01469 expressed protein similar to KED (GI:80... 97 7e-21 At2g40090.1 68415.m04927 ABC1 family protein contains Pfam domai... 32 0.40 At1g75150.1 68414.m08729 expressed protein ; expression supporte... 31 0.70 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 30 1.2 At5g60910.1 68418.m07641 agamous-like MADS box protein AGL8 / FR... 30 1.6 At4g02630.1 68417.m00357 protein kinase family protein contains ... 30 1.6 At5g51650.1 68418.m06404 hypothetical protein 29 2.1 At1g03910.1 68414.m00376 expressed protein low similarity to cac... 29 2.8 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 29 3.7 At5g10500.1 68418.m01216 kinase interacting family protein simil... 28 4.9 At4g26780.1 68417.m03857 co-chaperone grpE family protein simila... 28 4.9 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 28 4.9 At1g65010.1 68414.m07368 expressed protein similar to endosome-a... 28 4.9 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 28 6.5 At2g27670.1 68415.m03353 hypothetical protein contains Pfam prof... 28 6.5 At4g27595.1 68417.m03964 protein transport protein-related low s... 27 8.6 At3g16290.1 68416.m02056 FtsH protease, putative contains simila... 27 8.6 >At1g12650.1 68414.m01469 expressed protein similar to KED (GI:8096269) [Nicotiana tabacum]; similar to rRNA processing protein EBP2 (SP:P36049) [Saccharomyces cerevisiae] Length = 248 Score = 97.5 bits (232), Expect = 7e-21 Identities = 67/203 (33%), Positives = 113/203 (55%), Gaps = 8/203 (3%) Frame = +1 Query: 85 DEIEDNERTSIRSELASLSFEELQQLKEKIGAKVYKEALFGTKEKVNVPPKVFK----RE 252 ++ E++E S S S S EE + KE +++K G+K P +V K R Sbjct: 17 EDSEEDEDLSCSS--VSSSDEEEETEKELTFEEIHKLRADGSKAVPWKPNQVKKTGRARA 74 Query: 253 NKNRPREISSKKPVPVV-QVAHVKKKEVRDPRFDPLCGEFDKKQFSQNYGFLSELRMK-D 426 NKNRP E+SSKKPV +V HV KKEVRDPRF+ L G D + F + Y F E ++ + Sbjct: 75 NKNRPMEVSSKKPVSRYREVVHVPKKEVRDPRFNQLGGTLDVEGFRKRYNFFFEDKLPVE 134 Query: 427 IKAARQELRETTDPEK--QIKXXXXXXXXNDQHKACKRNKLDREVAQKNRDDIEKQFREG 600 + +++L++T +PE+ ++K +++ +NK + +++ + +EG Sbjct: 135 REELKKKLKKTKNPEEIDELKNQLTYVEKMLKYEPSTQNK-GAAILTEHKKKEREAAKEG 193 Query: 601 KQPHFKNKSELRVEALVKQYESL 669 K+P++ KSE+R + L+++Y SL Sbjct: 194 KRPYYLKKSEIRKQTLIEKYNSL 216 >At2g40090.1 68415.m04927 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 538 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -2 Query: 175 QFFPSIVEVLQKIRKPILIVLTSFRCLQFRPHENLHYLHCSSFLVVG 35 Q+F I E+L+++ + IL++L + CL+ +E + SFL++G Sbjct: 439 QYFSEISELLRRLPRVILLMLKTNDCLRSVNNELMQGSSLESFLIIG 485 >At1g75150.1 68414.m08729 expressed protein ; expression supported by MPSS Length = 753 Score = 31.1 bits (67), Expect = 0.70 Identities = 29/130 (22%), Positives = 52/130 (40%), Gaps = 5/130 (3%) Frame = +1 Query: 271 EISSKKPVPVVQVAHVKKKEVRDPRFDPLCGEFDK--KQFSQNYGFLSELRMKDIKAA-- 438 EIS + ++V+ + E DP F+ EFD ++ + E+R+ + K A Sbjct: 112 EISDSETRDEIRVSETTESEKEDPDFETTVHEFDSPMEELGEKGEDEEEIRVPETKEAGK 171 Query: 439 RQELRETTDPE-KQIKXXXXXXXXNDQHKACKRNKLDREVAQKNRDDIEKQFREGKQPHF 615 ++ + ET D E K+ K +D + + +K R + Q R Q Sbjct: 172 KRPIVETRDGEGKERKRDKKRKKKSDDFDELPVSTASMNMTKKERREYLDQLRAENQRLL 231 Query: 616 KNKSELRVEA 645 + + EA Sbjct: 232 RETRDAAFEA 241 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 30.3 bits (65), Expect = 1.2 Identities = 44/202 (21%), Positives = 80/202 (39%), Gaps = 27/202 (13%) Frame = +1 Query: 61 EDNEDSH--VDEIEDNERTSIRSELASLSFEELQQLKEKIG----AKVYKEALFGTKEKV 222 E++ SH VD +DN+ S S+ S S +E +KE+ G + + K K+ Sbjct: 719 ENDNGSHENVDVAQDNDLNSRHSKRRSKSLDEDYDMKERRGRSRSRSLETKNRSSRKNKL 778 Query: 223 NVPPKVFKRENKNRPREISSKKPVPVVQVAHVKK----------------KEVRDPRFDP 354 + R ++R + + K+ + KK K+ RD R P Sbjct: 779 DEDRNTGSRRRRSRSKSVEGKRSYNKETRSRDKKSKRRSGRRSRSPSSEGKQGRDIRSSP 838 Query: 355 LCGEFDK---KQFSQNYGFLSELRMKDIKAARQELRETTDP--EKQIKXXXXXXXXNDQH 519 + K K+ S++ + +D ++ R E ++ P +K+ ++ H Sbjct: 839 GYSDEKKSRHKRHSRSRSIEKKNSSRDKRSKRHERLRSSSPGRDKRRGDRSLSPVSSEDH 898 Query: 520 KACKRNKLDREVAQKNRDDIEK 585 K KR+ + V +K D EK Sbjct: 899 KIKKRHSGSKSVKEKPHSDYEK 920 >At5g60910.1 68418.m07641 agamous-like MADS box protein AGL8 / FRUITFULL (AGL8) NAP1-1, Nicotiana tabacum, EMBL:AF009126; identical to SP:Q38876 Agamous-like MADS box protein AGL8 (Floral homeotic protein AGL8) (FRUITFULL){Arabidopsis thaliana} PMID:9502732, PMID:10648231; identical to cDNA agamous-like 8 (AGL8) GI:1004364 Length = 242 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 76 SHVDEIEDNERTSIRSELASLSFEELQQLKEKIGAKV 186 + V+ +E N+R + +L SLS +ELQ L+ ++ A + Sbjct: 100 ARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAI 136 >At4g02630.1 68417.m00357 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 492 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 238 VFKRENKNRPREISSKKPVPVVQVAHVKKKEVRDP 342 +++R NKN+ E SSK +V V + +E+R P Sbjct: 46 IYRRSNKNKSLESSSKSNHTIVPVVSKEIQEIRPP 80 >At5g51650.1 68418.m06404 hypothetical protein Length = 206 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/86 (25%), Positives = 37/86 (43%) Frame = +1 Query: 367 FDKKQFSQNYGFLSELRMKDIKAARQELRETTDPEKQIKXXXXXXXXNDQHKACKRNKLD 546 FD K + G + +L+ K ++E + + ++ ND+ + KL Sbjct: 111 FDTKILEEEVGIIWDLKEKKKDKKKEEEEDDFGSKIKLTTADLRKLANDKQQL---KKLL 167 Query: 547 REVAQKNRDDIEKQFREGKQPHFKNK 624 RE +KN + IEK +E K K K Sbjct: 168 REFEKKNDEFIEKLMKEKKLEKNKRK 193 >At1g03910.1 68414.m00376 expressed protein low similarity to cactin [Drosophila melanogaster] GI:7673675; expression supported by MPSS Length = 672 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/42 (35%), Positives = 27/42 (64%) Frame = +1 Query: 148 ELQQLKEKIGAKVYKEALFGTKEKVNVPPKVFKRENKNRPRE 273 EL+ +K +GA +A+FG+ +VN+ +V+ +K RPR+ Sbjct: 516 ELKAMKA-MGAMEEGDAIFGSNAEVNLDSEVYWWHDKYRPRK 556 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 28.7 bits (61), Expect = 3.7 Identities = 26/102 (25%), Positives = 53/102 (51%), Gaps = 3/102 (2%) Frame = +1 Query: 373 KKQFSQNYGFLSELRMKDIKAARQELRETTDPEKQIKXXXXXXXXNDQHKACKRNKLDR- 549 +KQ + +L E R++++ ++ELR+ +KQ K + H A R KL++ Sbjct: 186 RKQIIEVVHYLDE-RLRELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDA--REKLEQV 242 Query: 550 EVAQ-KNRDDIEKQFREGKQPHFKNKS-ELRVEALVKQYESL 669 EVA+ K ++ K + ++ +KS + ++ L K+ ++L Sbjct: 243 EVARTKASEESTKMYDRVEKAQDDSKSLDESLKELTKELQTL 284 >At5g10500.1 68418.m01216 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 848 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 553 VAQKNRDDIEKQFREGKQPHFKNKSELRVEALVKQYESL 669 + QKN+D + R +P +K+ SE+R E V +SL Sbjct: 673 IKQKNQDGGKNTLRSNVRPIYKHLSEIRTEMTVWLEKSL 711 >At4g26780.1 68417.m03857 co-chaperone grpE family protein similar to chaperone GrpE type 2 [Nicotiana tabacum] GI:3851640; contains Pfam profile PF01025: co-chaperone GrpE Length = 327 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +1 Query: 52 SCSEDNEDSHVDEIEDNERTSI---RSELASLSFEELQQLKEKIGAKVYKE 195 S SE + +S DE+ ++ + + EL S EE++QLK+K+ + Y E Sbjct: 126 SSSESDSESDDDELSADDLVKLVAEKEELLSEKEEEIKQLKDKV-LRTYAE 175 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 28.3 bits (60), Expect = 4.9 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 2/100 (2%) Frame = +1 Query: 373 KKQFSQNYGFLSELRMKDIKAARQELRETTDPEKQIKXXXXXXXXNDQHKACKRNKLDRE 552 +KQ S NY +E R+ D++ LRE K+ N Q + KL + Sbjct: 740 EKQESANYKRSTESRLADLQKNVSFLREECRSRKREYEDELDRVVNKQVEIFILQKLIED 799 Query: 553 VAQKNRDDIEKQFREGKQPHFKNK--SELRVEALVKQYES 666 + QKN + + + + F K +EL E L +Q E+ Sbjct: 800 LEQKNFSLLIECQKHVEASEFSEKLIAELESENLEQQMEA 839 >At1g65010.1 68414.m07368 expressed protein similar to endosome-associated protein (GI:1016368) [Homo sapiens]; similar to Centromeric protein E (CENP-E protein) (Swiss-Prot:Q02224) [Homo sapiens] Length = 1318 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 28 IQYLLLKMSCSEDNEDSHVDEIEDNERTS-IRSELASLSFEELQQLKEKIGAKVYKEALF 204 +Q + ++S + D ++ + E+ + + I +E A + EL +LK +G+K KEA+ Sbjct: 166 LQRVKHELSMTADAKNKALSHAEEATKIAEIHAEKAEILASELGRLKALLGSKEEKEAIE 225 Query: 205 GTK 213 G + Sbjct: 226 GNE 228 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 58 SEDNEDSHVDEIEDNERTSIRSELASL-SFEELQQLKEKIGAKV 186 S + D+H DEIE N ++R+ L SL S + L+ K + G+K+ Sbjct: 8 SRRDSDNHDDEIE-NVPENLRASLLSLTSNDSLKNPKHECGSKI 50 >At2g27670.1 68415.m03353 hypothetical protein contains Pfam profile PF02713: Domain of unknown function DUF220 Length = 293 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 97 DNERT-SIRSELASLSFEELQQLKEKIGAKVYKEALFGTKEKVNVPP 234 D ER RS + +++ K +IG+KV E +F +NVPP Sbjct: 213 DQERLCKSRSRINEEEYKKCSDGKGRIGSKVTMEQIFQPCSLLNVPP 259 >At4g27595.1 68417.m03964 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1212 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 70 EDSHVDEIEDNERTSIRSELASLSFEELQQLKEKI 174 E S +D+ +N+ +R A+ EEL ++KE + Sbjct: 995 EQSWIDKGNENQELKVREASAAKRIEELSKMKESL 1029 >At3g16290.1 68416.m02056 FtsH protease, putative contains similarity to cell division protein FtsH GI:1652085 from [Synechocystis sp. PCC 6803] Length = 876 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = +1 Query: 298 VVQVAHVKKKEVRDPRFDPLCGEFDKKQFSQNYGFLSELRMKDIKAARQELRETTD 465 V+ +A + ++ DP G FD+K F G + + + + A ++ + E D Sbjct: 549 VITIASTNRPDILDPAL-VRPGRFDRKIFIPKPGLIGRMEILQVHARKKPMAEDLD 603 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.312 0.130 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,189,685 Number of Sequences: 28952 Number of extensions: 224423 Number of successful extensions: 686 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -