BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j08 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 2.7 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.2 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 8.2 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 370 SGVHQINILDEE-GWASLRRARRADPAASVAPLLAIQLSHPGSY 498 S H++ I E+ G S+ + R P+A + + ++L+HP Y Sbjct: 399 SSTHEMAIPREDIGVKSVHQHPRYSPSALLNNIAVLELAHPVQY 442 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 6.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 259 PENYGLYAEVDGKSLTAARIGENKYQISWTEE 354 PEN G +A K++ +GE Q W E Sbjct: 53 PENNGRWAFSSCKAVAVVAVGELPIQRVWCSE 84 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 495 AARMTKLYGE*WSNRGGRIGTSSTTQRSPA 406 AAR +KLY S+ G +G S P+ Sbjct: 158 AARSSKLYTSKGSSSSGNLGASGVPGAEPS 187 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,653 Number of Sequences: 2352 Number of extensions: 11094 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -