BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j04 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1... 27 2.7 SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po... 27 3.5 SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo... 25 8.2 >SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 27.1 bits (57), Expect = 2.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 286 IISHGLCSSGIFCLANINYERLHSRSLYINRGMINFI 396 ++S GL SSGI L I + YI GM++ + Sbjct: 105 LVSAGLISSGIMTLIQIARVHIPKTKYYIGTGMLSVL 141 >SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 937 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 688 LKLSYLKEINAKIIINTHEMNQHKIYINLENIYHVEYKN 572 LKL+ +EIN II THE+ Q +I N + + +N Sbjct: 70 LKLAENQEINLSIIDCTHEIEQLEIEPVTSNDWEIAERN 108 >SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizosaccharomyces pombe|chr 1|||Manual Length = 1604 Score = 25.4 bits (53), Expect = 8.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 646 INTHEMNQHKIYINLENIYHVEYKNISINYN 554 +NT + K NL NI++ EY N SI N Sbjct: 1201 LNTSRGFETKYLYNLMNIWNPEYTNDSIKSN 1231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,983,494 Number of Sequences: 5004 Number of extensions: 31527 Number of successful extensions: 65 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -