BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j04 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 25 1.8 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 25 2.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.2 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 25.4 bits (53), Expect = 1.8 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -2 Query: 637 HEMNQHKIYINLENIYHVEYKNISINYN 554 H Q K++ L+++ V+Y+++ + YN Sbjct: 27 HPEIQEKLHQELQDVLGVDYRHVPLTYN 54 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 25.0 bits (52), Expect = 2.3 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -2 Query: 637 HEMNQHKIYINLENIYHVEYKNISINYN 554 H Q K+Y ++++ EY+++ + YN Sbjct: 18 HPEIQEKLYREIQDVLGGEYRHVPLTYN 45 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 7.2 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 7/54 (12%) Frame = -2 Query: 688 LKLSYLKEINAKIIINTHEMNQH-------KIYINLENIYHVEYKNISINYNQH 548 + LSY ++ A I + TH+ QH + L+ I ++K Y+QH Sbjct: 615 IDLSYSEDRLADITVATHQFIQHFTFHYSKDVKPLLQTIQQSDHKLFDFEYDQH 668 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 473,725 Number of Sequences: 2352 Number of extensions: 7536 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -