BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j04 (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084152-2|AAM69073.2| 1571|Caenorhabditis elegans Hypothetical ... 31 0.62 >AC084152-2|AAM69073.2| 1571|Caenorhabditis elegans Hypothetical protein Y102A11A.3 protein. Length = 1571 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -2 Query: 673 LKEINAKIIINTHEMNQHKIYIN-LENIYHVEYKN---ISINYN 554 LK +N+K++INT + ++ + IN +++ YH +N SIN N Sbjct: 807 LKTVNSKVLINTEFLQENSLTINVIDSCYHENIQNHVLSSINNN 850 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,460,663 Number of Sequences: 27780 Number of extensions: 163167 Number of successful extensions: 406 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -