BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j03 (554 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 5.5 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 5.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 5.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.5 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 9.5 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 5.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 112 EEEPIVLLHWPFRFL 68 EE P V + PFRFL Sbjct: 485 EERPDVKIFLPFRFL 499 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 5.5 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -1 Query: 308 PPYSGRRTLSPTLT*TGMKSPFSFRAPGPTATTSPCKTLD*AFS 177 P Y + LSP+ T FR P T + K++ +FS Sbjct: 188 PTYQTQGLLSPSYGGTTYSFTADFRPPQETPVLASYKSVPMSFS 231 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 460 IWSCIFCEVLILSQLQYLHFL 522 I C FC+ +S+ Y H L Sbjct: 1053 IMKCAFCDTPFISKGAYRHHL 1073 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 9.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 78 NGQCSKTIGSSSGPCPDQKS*SYNQNCRRHCHPREGSIQG 197 +GQ +T+G +S P + + SY + RE QG Sbjct: 711 HGQWERTVGHNSPLFPLESATSYQKKLTVDFSAREWVKQG 750 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 333 IIFKAYFST-AVFWKKNFITHTNLNGDEVSIFFSGSR 226 + F A F T +FW+ + I + + ++ F+GSR Sbjct: 244 LFFLANFLTNLLFWEFDQIVNVAYRMETWNVVFNGSR 280 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,707 Number of Sequences: 336 Number of extensions: 2295 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -