BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i22 (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0344 + 3043824-3044123,3044260-3044314,3044810-3044985,304... 29 3.9 02_01_0567 - 4168164-4168250,4168672-4168828,4168951-4169090,417... 28 6.8 >08_01_0344 + 3043824-3044123,3044260-3044314,3044810-3044985, 3045083-3045283,3045383-3045642,3045909-3046222, 3046399-3046622,3047046-3047398,3047709-3047826, 3047875-3048133,3048252-3049729 Length = 1245 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 495 KPDLNGYTNGIPAHKIVVNIFSCQNGRSTITQCIK 599 KP L G++ IPA K+V + S G+ST+ ++ Sbjct: 394 KPILQGFSLSIPAGKVVALVGSSGCGKSTVISLLQ 428 >02_01_0567 - 4168164-4168250,4168672-4168828,4168951-4169090, 4170318-4170456,4170562-4170830,4170914-4171000, 4171259-4171327,4171427-4171455,4171544-4171950, 4172906-4172977,4173150-4173221,4173299-4173370, 4173454-4173519,4173717-4173785,4173866-4173995, 4174846-4174975 Length = 664 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = +3 Query: 249 LKLIVKHIPKLSKQPK---HLVVLSDSDYHSIDDLARMV 356 L+L+ P S +P+ HLV +DS +H I+ +++MV Sbjct: 573 LELLTGRKPYDSSRPRAEQHLVRWADSQFHDIESISKMV 611 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,537,630 Number of Sequences: 37544 Number of extensions: 243473 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -