BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i14 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48178| Best HMM Match : RVT_1 (HMM E-Value=0.013) 30 2.0 SB_43548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_33703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_38362| Best HMM Match : BRCT (HMM E-Value=0) 28 8.0 >SB_48178| Best HMM Match : RVT_1 (HMM E-Value=0.013) Length = 1105 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/72 (30%), Positives = 34/72 (47%) Frame = +3 Query: 459 EVDVDELLSKLTQEELTMLAKEVDPDDNFLPPSQRNNYACEKDPTGPLNRKKLIEHINKQ 638 E + D+L EE + +A + P+D PPSQR + + R +L + K+ Sbjct: 413 EDEPDDLNLDSEHEEQSKMAA-MPPEDEISPPSQRGQKELVR-LLEKMLRNRLPDKTLKE 470 Query: 639 ALETPDRPEVKP 674 L+ DRPE P Sbjct: 471 KLDKQDRPENCP 482 >SB_43548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 772 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 522 EVDPDDNFLPPSQRNNYACEKDPTGPLNRKKLIEHINKQALETPDRPEV 668 EVD L P Q Y E+D + R+ I +N A+++ D P V Sbjct: 394 EVDITVKELDPEQDQAYRQERDYHYDIQRRHCISTMNSTAIDSRDFPRV 442 >SB_33703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -2 Query: 618 SVSCDSTDRWDPSRKRSCYAVTVEGNCRQ 532 S SC+S W PS + S A V G RQ Sbjct: 253 SNSCNSNQLWKPSLRSSSKAFDVSGTIRQ 281 >SB_38362| Best HMM Match : BRCT (HMM E-Value=0) Length = 1572 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 585 DPTGPLNRKKLIEHINKQALETPD 656 DP G L R+K++ +NK+ +PD Sbjct: 1209 DPAGRLEREKIMAQLNKRCSPSPD 1232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,204,598 Number of Sequences: 59808 Number of extensions: 399096 Number of successful extensions: 1116 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1115 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -