BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i08 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 25 0.95 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 25 0.95 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.2 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.8 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 24.6 bits (51), Expect = 0.95 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 475 HPHEGSMY*VTKPPPVFMTALPEDGML 395 H H G++Y + P T PEDG L Sbjct: 105 HDHLGTLYPGMRAPSFRCTERPEDGAL 131 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 24.6 bits (51), Expect = 0.95 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 475 HPHEGSMY*VTKPPPVFMTALPEDGML 395 H H G++Y + P T PEDG L Sbjct: 105 HDHLGTLYPGMRAPSFRCTERPEDGAL 131 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 470 WMWTSIGTLRRSIDINHNIFAHN*T 544 W+WT G +RR++ ++ H+ T Sbjct: 176 WIWTPHGWMRRNVLNKQHVHFHDYT 200 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 15 GTSTEMESGGVLAVILVLIQGILSLPMSGNGCLGS 119 G S ++E+G I +++ G + +S GC G+ Sbjct: 39 GVSKQIETGLAFPSITLIVLGSIIFVISFFGCCGA 73 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,953 Number of Sequences: 438 Number of extensions: 4685 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -