BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i06 (763 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 31 1.4 SB_32120| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-32) 28 9.5 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/46 (28%), Positives = 28/46 (60%) Frame = +2 Query: 614 QYKLASVLVLNKFQVSINIILYSLFNTKNTIYTXVSFVAITXKSSR 751 QY+ S ++ + Q + + +LY+L NTK T+ + ++ + + K+ R Sbjct: 318 QYQFLSEILKWRAQATPDHVLYTLLNTKGTVSSALTSIQLQKKADR 363 >SB_32120| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-32) Length = 459 Score = 27.9 bits (59), Expect = 9.5 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = +2 Query: 515 LKPKLFRKYFETYFIK*GPIHKSIISNSYILEK-QYKLAS---VLVLNKFQVSINIILYS 682 +KP L+RKYF +++ + +NS LEK +Y+L S V+ + I I+L Sbjct: 160 VKPSLYRKYFTMHYLH--VLFAMTPNNSLNLEKMEYELLSRGLAQVVMESGALILIMLII 217 Query: 683 LFNTKNTIY 709 F T+Y Sbjct: 218 FFGNSLTLY 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,433,792 Number of Sequences: 59808 Number of extensions: 405819 Number of successful extensions: 875 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -