BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i06 (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 40 8e-05 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.9 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 25 2.5 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 4.5 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 4.5 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 5.9 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 7.8 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 39.9 bits (89), Expect = 8e-05 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +1 Query: 187 CLKDALNEYIPKLATGLPEYGVPPSEPLIVPSISIQQSTGPITVTSSYSDVTVRGPSKMR 366 C+ A+ K G+P G+ +PL + + I Q TGP+ + ++ +V + G + Sbjct: 36 CVVQAITNTFQKFQGGVPALGLASLDPLRIDEMDIVQGTGPVNIVLNFKNVDITGFKDVA 95 Query: 367 IK 372 +K Sbjct: 96 VK 97 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 404 RNIIFKSHWTSLIRIFEGPR 345 R I S W S I+IFEG R Sbjct: 260 RAITVNSEWRSFIKIFEGVR 279 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 25.0 bits (52), Expect = 2.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 23 FVHYFIVQCYCQCAREDL 76 F YF+V C QC E+L Sbjct: 59 FQAYFVVNCLAQCQLEEL 76 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 4.5 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -3 Query: 341 VTSEYDEVTVMGPVDCWIEI 282 +T Y+E + G + CWI++ Sbjct: 359 ITYFYEERLIQGKMQCWIDL 378 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.2 bits (50), Expect = 4.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 114 HIFNSDYNYSW 146 H NSDY Y+W Sbjct: 1702 HFMNSDYEYNW 1712 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 5.9 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -2 Query: 387 VSLDILNSHLRGPSDRN--IRVRRSNRD 310 VS + SH GPSDRN I RR R+ Sbjct: 1044 VSSTLSPSHPVGPSDRNQVIAARRERRN 1071 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.4 bits (48), Expect = 7.8 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +1 Query: 232 GLPEYGVPPSEPLIVPSISIQQSTGPITVTSSYSDVTVRGPS 357 G PP++ P Q+++ P V S V + GPS Sbjct: 208 GKTPLATPPTKEKRKPFFKKQETSSPYDVVPSMRPVVLVGPS 249 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,553 Number of Sequences: 2352 Number of extensions: 14157 Number of successful extensions: 41 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -