BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i05 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1468| Best HMM Match : PK (HMM E-Value=2.2e-19) 75 5e-14 SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_26849| Best HMM Match : FlgH (HMM E-Value=7.5) 29 4.6 SB_23275| Best HMM Match : IncA (HMM E-Value=0.43) 29 4.6 SB_44208| Best HMM Match : DHHA2 (HMM E-Value=8.3) 28 6.1 SB_47118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_18036| Best HMM Match : DUF29 (HMM E-Value=8) 28 6.1 SB_4541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_1468| Best HMM Match : PK (HMM E-Value=2.2e-19) Length = 211 Score = 74.9 bits (176), Expect = 5e-14 Identities = 32/58 (55%), Positives = 44/58 (75%) Frame = +3 Query: 159 SQLQHMCGLDIDSKSSYIRLSGIICTIGPASRNVAVLEKMMETGMNVARMNFSHGSHE 332 S L+ LDID IR SG++CTIGPASR+V ++ +++E GMN+AR+NFSHG+HE Sbjct: 28 SNLEFRSELDIDKHPLTIRNSGVVCTIGPASRSVEIVAQLIENGMNIARLNFSHGTHE 85 Score = 61.7 bits (143), Expect = 5e-10 Identities = 25/64 (39%), Positives = 42/64 (65%) Frame = +3 Query: 444 RTGLLEGGGSAEVELKKGETIKLTTSSDYQEKGNADTIYVDYKNITNVVKPGNRIFIDDG 623 R G E++L+KG+ +K++T ++GN + I+VDY+NI VV+ G +++DDG Sbjct: 76 RLNFSHGTHEGEIKLEKGQKLKVSTDKAMYDQGNTECIFVDYENIVKVVQIGGTVYVDDG 135 Query: 624 LISI 635 LIS+ Sbjct: 136 LISL 139 >SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 32.3 bits (70), Expect = 0.37 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 15/163 (9%) Frame = +3 Query: 108 TMAFAGAVEKPTVANVGSQLQHMCGLDIDSKSSYIRLSGIICTIGPASRNVAVLEKMMET 287 T +E A GS+ + + L+ ++ R+ + C + R +++ +E Sbjct: 274 TAGIRSELENTKKALKGSE-ERVSSLEKTVEARESRIRTLECRVDELERQKKKIKEELEC 332 Query: 288 ---GMNVARMNFSHGSHEY--HAETIRNCREAEKSYSAKLGSPFSLAIALDTKGPEI--- 443 AR + S EY HA+ ++ E A L +ALDTK E+ Sbjct: 333 VSFNTQAARASKSQLLREYDEHAKEMKRLEEELNKAKASLKDKQDQLLALDTKYKELIAD 392 Query: 444 -------RTGLLEGGGSAEVELKKGETIKLTTSSDYQEKGNAD 551 GL E SA ELKK E + +++ Q G+++ Sbjct: 393 NEGLKDQMRGLRETANSATQELKKKEQLLRALATERQSSGDSE 435 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 30.7 bits (66), Expect = 1.1 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 3/101 (2%) Frame = +3 Query: 252 RNVAVLEKMMETG--MNVARMNFSHGSHEYHAETIRNCREAEKSYSAKLGSPFSLAI-AL 422 RN A LE+ G + +AR NF E A+T + C E + ++++ + AL Sbjct: 155 RNEAALEREQAVGDALAIARKNFERRRKEVIAQTRQQCEEEAATEASRVARLHQQEVGAL 214 Query: 423 DTKGPEIRTGLLEGGGSAEVELKKGETIKLTTSSDYQEKGN 545 D + +++ L S KK + L DY+ N Sbjct: 215 DQRIDDLKNML----ASERAAAKKLAGVHLALKEDYKRFQN 251 >SB_26849| Best HMM Match : FlgH (HMM E-Value=7.5) Length = 317 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 475 AEPPPSKSPVLISGPLVSNAMAKEKGEP 392 A PPPS+SPV +G +S+A +K +P Sbjct: 17 ALPPPSESPVWRTGNALSSAKKDKKRQP 44 >SB_23275| Best HMM Match : IncA (HMM E-Value=0.43) Length = 1176 Score = 28.7 bits (61), Expect = 4.6 Identities = 46/198 (23%), Positives = 75/198 (37%), Gaps = 20/198 (10%) Frame = +3 Query: 129 VEKPT-VANVGSQLQHMCGLDIDSKSSYIRLSGIICTIGPASRNVAVLEKMMETGMNVAR 305 +EKP +A G + C + S+ + II I + L++ ++ GM + Sbjct: 382 IEKPRFIALRGCAFHNRCN-SLSSEGTVSDGENIILRIPAGQYTIETLKRQIDGGMRLGE 440 Query: 306 MNFS--HGSHEYHAETIRN----C------REAEKSYSAKLGSPFSLAIALDTKGPEIRT 449 S S E H + N C RE E + K+ + AI + Sbjct: 441 KPISIRDSSLEVHRNVVLNEPLACLLGLKTRELEANTRHKIKTIGHEAIFIHCDLVNASD 500 Query: 450 GLLEGGGS---AEVELKKGETIKLTTSSDYQEKGNADTIYVDYKNITNVVKPGNRIF--- 611 L +G S A VEL +G+ + + G+ + Y+N+ K G +F Sbjct: 501 SLQQGAPSQILASVELDEGKIYLNPSDPTHDVLGSLEQEVKHYENVRKKYKRGQSVFSKL 560 Query: 612 -IDDGLISIICQSVSADT 662 + GLIS+I S T Sbjct: 561 SVVLGLISVILGSSGLGT 578 >SB_44208| Best HMM Match : DHHA2 (HMM E-Value=8.3) Length = 289 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 330 EYHAETIRNCREAEKSYSAKLGSPFSLAIALDTKGPEI 443 E HA+ + A+KSY L S +LA LD P++ Sbjct: 4 ELHADKKESLERAQKSYEKLLASTSNLADVLDEDMPDL 41 >SB_47118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 330 EYHAETIRNCREAEKSYSAKLGSPFSLAIALDTKGPEI 443 E HA+ + A+KSY L S +LA LD P++ Sbjct: 287 ELHADKKESLERAQKSYEKLLASTSNLADVLDEDMPDL 324 >SB_18036| Best HMM Match : DUF29 (HMM E-Value=8) Length = 125 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 330 EYHAETIRNCREAEKSYSAKLGSPFSLAIALDTKGPEI 443 E HA+ + A+KSY L S +LA LD P++ Sbjct: 84 ELHADKKESLERAQKSYEKLLASTSNLADVLDEDMPDL 121 >SB_4541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 330 EYHAETIRNCREAEKSYSAKLGS 398 E+H E IR +EA KSY K GS Sbjct: 119 EHHEEAIRRHKEALKSYEKKDGS 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,919,569 Number of Sequences: 59808 Number of extensions: 408943 Number of successful extensions: 1215 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -