BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i05 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.0 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.2 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 259 TLRDAGPIVQIIPERRMYEDLESMSRPHICWSWEPT 152 +++ A IV I PER D E CWS EP+ Sbjct: 809 SVKKALMIVGIRPERLPSFDDECWRLMEQCWSGEPS 844 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 259 TLRDAGPIVQIIPERRMYEDLESMSRPHICWSWEPT 152 +++ A IV I PER D E CWS EP+ Sbjct: 847 SVKKALMIVGIRPERLPSFDDECWRLMEQCWSGEPS 882 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.2 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 638 DDRDEAIIDEDSVSWLHDIRYVLVVHVNCI 549 DD +AIID D S +I L V CI Sbjct: 71 DDLIKAIIDSDRHSTTREIAEKLHVSHTCI 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,319 Number of Sequences: 438 Number of extensions: 3583 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -