BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i02 (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 27 0.19 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 1.0 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.4 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 5.4 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.2 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.2 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 21 9.5 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 27.1 bits (57), Expect = 0.19 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 327 HSDYDNRFSLSHSDQFVNG-SDTSSGKLR*QD 235 H+D N SL+H DQ G + T SGK R Q+ Sbjct: 795 HTDIGNSQSLAHQDQCCPGFTMTKSGKTRHQN 826 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.6 bits (51), Expect = 1.0 Identities = 14/71 (19%), Positives = 34/71 (47%) Frame = +1 Query: 349 DLSKRRVSAEDIYKCTERYAKAKAVNSILRHVAELLHYETSEQLEELYKKTAWYFEEKYK 528 D+ + ++ I + TE K ++S++ + LHYET + ++ W + + + Sbjct: 678 DICQLLKDSQYIREQTESDDKEGYLHSVVSGALDRLHYETDPCVRYYPRRKEWLYLHRAR 737 Query: 529 KKASAYDFFKQ 561 + S ++ + Q Sbjct: 738 SE-SEFEMYHQ 747 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 394 CTCIYLQQIHDVSISLCILFLCP 326 C CIY+Q I+ +LCP Sbjct: 183 CKCIYVQSINLCMAGRLFGYLCP 205 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 730 KLLVQHQCLHNHSK 689 KL V H C+ NH K Sbjct: 92 KLHVSHTCIENHLK 105 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 354 IETSCIC*RYIQVH-RTLRKSKSSKLD 431 I SCIC R+I H + L S K D Sbjct: 484 IHKSCICVRFIAEHTKMLEDSTKVKED 510 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 354 IETSCIC*RYIQVH-RTLRKSKSSKLD 431 I SCIC R+I H + L S K D Sbjct: 484 IHKSCICVRFIAEHTKMLEDSTKVKED 510 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 715 HQCLHNHSKHTQCQHESSLLA 653 H C HN H + E+ LLA Sbjct: 23 HHCHHNGVVHRDLKPENLLLA 43 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,269 Number of Sequences: 438 Number of extensions: 3325 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -