BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11i01 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 5.9 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 5.9 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 5.9 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 5.9 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 5.9 AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 prote... 24 5.9 AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. 24 5.9 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 5.9 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 520 DASVKIFFR*LKLYLSYISIVKEL-FHYHSYI 612 +++V FF KLYL ++KE FHY ++ Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFV 210 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 520 DASVKIFFR*LKLYLSYISIVKEL-FHYHSYI 612 +++V FF KLYL ++KE FHY ++ Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFV 210 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 520 DASVKIFFR*LKLYLSYISIVKEL-FHYHSYI 612 +++V FF KLYL ++KE FHY ++ Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFV 210 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 520 DASVKIFFR*LKLYLSYISIVKEL-FHYHSYI 612 +++V FF KLYL ++KE FHY ++ Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFV 210 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 520 DASVKIFFR*LKLYLSYISIVKEL-FHYHSYI 612 +++V FF KLYL ++KE FHY ++ Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFV 210 >AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 protein protein. Length = 165 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 192 CETNTGEVYRGKLIEAEDNMNCQMTLVTVTYRDGR 296 CE E+ G E + +++C M + Y DGR Sbjct: 40 CEIRRYEIIEGP--EMDKHIHCVMRALDFVYEDGR 72 >AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. Length = 165 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 192 CETNTGEVYRGKLIEAEDNMNCQMTLVTVTYRDGR 296 CE E+ G E + +++C M + Y DGR Sbjct: 40 CEIRRYEIIEGP--EMDKHIHCVMRALDFVYEDGR 72 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 520 DASVKIFFR*LKLYLSYISIVKEL-FHYHSYI 612 +++V FF KLYL ++KE FHY ++ Sbjct: 406 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFV 437 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,480 Number of Sequences: 2352 Number of extensions: 13795 Number of successful extensions: 63 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -