BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h24 (603 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 150 1e-36 05_03_0281 + 11560402-11560569,11561373-11561579,11562966-115631... 37 0.014 01_01_1052 + 8297105-8297422,8298978-8299310,8299820-8301010 36 0.025 07_03_1165 - 24459156-24460139 34 0.100 09_04_0210 + 15644151-15644609 30 1.2 02_05_0473 + 29319824-29322511,29322659-29322820,29324133-293242... 30 1.6 12_02_0397 + 18581301-18581561,18581584-18581676 28 6.5 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 150 bits (363), Expect = 1e-36 Identities = 60/93 (64%), Positives = 78/93 (83%) Frame = +1 Query: 160 MGRKKKKASKPWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 339 MG+KKK+ K +C+YC+REFDDEKIL+QHQKAKHFKCH+CHKKL T G++IH +QVHKE Sbjct: 1 MGKKKKRVEKVFCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHKE 60 Query: 340 AIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEH 438 ++ KVPN+ P R + EIEI+GM+GIPP+ + H Sbjct: 61 SVTKVPNAKPERESTEIEIFGMQGIPPDVLAAH 93 >05_03_0281 + 11560402-11560569,11561373-11561579,11562966-11563174, 11563261-11563309,11563611-11563673,11563799-11565472 Length = 789 Score = 36.7 bits (81), Expect = 0.014 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 181 ASKPWCWYCNREFDDEKILIQHQKAKHFKCHICHKK 288 A P C +C F + L H +H+ CHIC ++ Sbjct: 161 AGHPMCEFCRSSFYGDNELYTHMSREHYSCHICQRQ 196 >01_01_1052 + 8297105-8297422,8298978-8299310,8299820-8301010 Length = 613 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = +1 Query: 190 PWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 333 P C +C F + L H +HF CHIC + LS Q H Sbjct: 145 PMCEFCKSPFYGDNELYTHMTREHFSCHICQRYSARLQSLSYLVRQQH 192 >07_03_1165 - 24459156-24460139 Length = 327 Score = 33.9 bits (74), Expect = 0.100 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 220 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLP 369 DD+ + ++ F CH+C+K+ + + H M+VH +K P SLP Sbjct: 99 DDDAAPVAARREASFPCHLCNKEFGSRKAVHGH-MRVHHAENEKEPMSLP 147 >09_04_0210 + 15644151-15644609 Length = 152 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 196 CWYCNREFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIH 318 C YC+R+FD + L HQ A ++ + ++ L H Sbjct: 36 CMYCDRKFDSSQALGGHQNAHKYERSLAKRRREIAAALRAH 76 >02_05_0473 + 29319824-29322511,29322659-29322820,29324133-29324249, 29324360-29324469,29324504-29324540,29324696-29324862, 29325002-29325089,29325163-29325270 Length = 1158 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +1 Query: 214 EFDDEKILIQHQKAKH----FKCHICHKKLYTGPGLSIHCMQVHKEAI 345 E D +++ + H KC IC ++ GL +H +VHK+ + Sbjct: 443 ENQDGSVMVLREDGTHPSPGLKCKICSQEFSDDQGLGLHWTEVHKKEV 490 >12_02_0397 + 18581301-18581561,18581584-18581676 Length = 117 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -2 Query: 236 RIFSSSNSLLQYQHQGLDAFFFF 168 R+F++ N+++Q QH L A+F F Sbjct: 86 RMFANINNMMQQQHDDLQAYFRF 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,725,066 Number of Sequences: 37544 Number of extensions: 273610 Number of successful extensions: 906 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -