BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h22 (595 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 1.1 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 24 1.1 AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 23 2.6 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.6 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.6 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 5.9 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -2 Query: 282 IPKLIWAVFNISFLMTHKCWSSWF-INLLWRINFLVILN--KRFWCSRL 145 +P +I A +SFLM H+ + + N++ + F I N + W +L Sbjct: 168 LPNVILACHMLSFLMVHQGETQFVAANVILKTRFKTINNILENLWAKKL 216 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 518 RTSPNLPRACLLIPLNTIPFPENDSATQRLLLNSTLWSLMAI 393 R SPN + L + + P SAT NS++WS +I Sbjct: 183 RDSPNYIKPQLHVSTGSTSSPTIASATYTNSANSSIWSPASI 224 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 22.6 bits (46), Expect = 2.6 Identities = 5/20 (25%), Positives = 14/20 (70%) Frame = -2 Query: 246 FLMTHKCWSSWFINLLWRIN 187 F++TH+ + WF +++ ++ Sbjct: 54 FIVTHQAYELWFKQIIYELD 73 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 2.6 Identities = 5/20 (25%), Positives = 14/20 (70%) Frame = -2 Query: 246 FLMTHKCWSSWFINLLWRIN 187 F++TH+ + WF +++ ++ Sbjct: 54 FIVTHQAYELWFKQIIYELD 73 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 2.6 Identities = 5/20 (25%), Positives = 14/20 (70%) Frame = -2 Query: 246 FLMTHKCWSSWFINLLWRIN 187 F++TH+ + WF +++ ++ Sbjct: 54 FIVTHQAYELWFKQIIYELD 73 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 Query: 108 QFSHQFVTSSMDKGDCTK 161 Q + ++ +DKG CTK Sbjct: 36 QMTRNYLDCVLDKGKCTK 53 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,291 Number of Sequences: 336 Number of extensions: 3383 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -