BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h19 (665 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04220.1 68417.m00598 disease resistance family protein conta... 41 9e-04 At2g17440.1 68415.m02012 leucine-rich repeat family protein cont... 40 0.001 At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 38 0.005 At5g49290.1 68418.m06100 leucine-rich repeat family protein cont... 38 0.008 At1g61300.1 68414.m06909 disease resistance protein (NBS-LRR cla... 37 0.010 At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR ... 36 0.018 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 36 0.024 At1g61310.1 68414.m06910 disease resistance protein (CC-NBS-LRR ... 36 0.032 At4g20140.1 68417.m02947 leucine-rich repeat transmembrane prote... 35 0.042 At1g61180.1 68414.m06894 disease resistance protein (CC-NBS-LRR ... 35 0.042 At1g34420.1 68414.m04275 leucine-rich repeat family protein / pr... 35 0.042 At5g44700.1 68418.m05477 leucine-rich repeat transmembrane prote... 34 0.074 At5g01890.1 68418.m00108 leucine-rich repeat transmembrane prote... 34 0.074 At4g20940.1 68417.m03034 leucine-rich repeat family protein cont... 34 0.074 At4g08850.2 68417.m01455 leucine-rich repeat family protein / pr... 34 0.074 At4g08850.1 68417.m01454 leucine-rich repeat family protein / pr... 34 0.074 At2g41820.1 68415.m05168 leucine-rich repeat transmembrane prote... 34 0.098 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 34 0.098 At1g71400.1 68414.m08246 disease resistance family protein / LRR... 34 0.098 At5g59670.1 68418.m07481 leucine-rich repeat protein kinase, put... 33 0.17 At3g13380.1 68416.m01683 leucine-rich repeat family protein / pr... 33 0.17 At2g33050.1 68415.m04053 leucine-rich repeat family protein cont... 33 0.17 At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, put... 33 0.17 At5g66330.1 68418.m08363 leucine-rich repeat family protein cont... 32 0.30 At5g45780.1 68418.m05630 leucine-rich repeat transmembrane prote... 32 0.30 At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, put... 32 0.30 At3g17640.1 68416.m02253 leucine-rich repeat family protein cont... 32 0.30 At1g74360.1 68414.m08615 leucine-rich repeat transmembrane prote... 32 0.30 At5g37450.1 68418.m04507 leucine-rich repeat transmembrane prote... 32 0.39 At5g06970.1 68418.m00789 expressed protein 32 0.39 At3g25560.1 68416.m03178 protein kinase family protein contains ... 32 0.39 At2g34930.1 68415.m04288 disease resistance family protein conta... 32 0.39 At2g33060.1 68415.m04054 leucine-rich repeat family protein cont... 32 0.39 At1g55610.1 68414.m06365 protein kinase family protein contains ... 32 0.39 At1g35710.1 68414.m04439 leucine-rich repeat transmembrane prote... 32 0.39 At1g58190.1 68414.m06605 leucine-rich repeat family protein cont... 31 0.52 At1g47890.1 68414.m05333 disease resistance family protein conta... 31 0.52 At2g15080.2 68415.m01719 disease resistance family protein conta... 31 0.69 At2g15080.1 68415.m01718 disease resistance family protein conta... 31 0.69 At1g78980.1 68414.m09209 leucine-rich repeat transmembrane prote... 31 0.69 At4g30520.1 68417.m04333 leucine-rich repeat family protein / pr... 31 0.91 At3g46330.1 68416.m05017 leucine-rich repeat protein kinase, put... 31 0.91 At3g25670.1 68416.m03195 leucine-rich repeat family protein cont... 31 0.91 At3g20820.1 68416.m02633 leucine-rich repeat family protein cont... 31 0.91 At3g13065.1 68416.m01632 leucine-rich repeat transmembrane prote... 31 0.91 At3g11080.1 68416.m01339 disease resistance family protein conta... 31 0.91 At3g05650.1 68416.m00629 disease resistance family protein conta... 31 0.91 At1g49360.1 68414.m05533 F-box family protein contains Pfam PF00... 31 0.91 At1g07390.1 68414.m00788 leucine-rich repeat family protein cont... 31 0.91 At1g74190.1 68414.m08592 leucine-rich repeat family protein cont... 30 1.2 At1g74170.1 68414.m08590 leucine-rich repeat family protein cont... 30 1.2 At3g53240.1 68416.m05868 leucine-rich repeat family protein cont... 30 1.6 At3g05370.1 68416.m00586 disease resistance family protein conta... 30 1.6 At2g29000.1 68415.m03527 leucine-rich repeat family protein / pr... 30 1.6 At1g12970.1 68414.m01506 leucine-rich repeat family protein 30 1.6 At5g07910.1 68418.m00914 leucine-rich repeat family protein cont... 29 2.1 At4g03260.1 68417.m00445 leucine-rich repeat family protein cont... 29 2.1 At2g33020.1 68415.m04047 leucine-rich repeat family protein cont... 29 2.1 At2g01950.1 68415.m00130 leucine-rich repeat transmembrane prote... 29 2.1 At1g33590.1 68414.m04158 disease resistance protein-related / LR... 29 2.1 At5g48940.1 68418.m06054 leucine-rich repeat transmembrane prote... 29 2.8 At3g24240.1 68416.m03042 leucine-rich repeat transmembrane prote... 29 2.8 At3g05360.1 68416.m00584 disease resistance family protein / LRR... 29 2.8 At2g25470.1 68415.m03050 leucine-rich repeat family protein cont... 29 2.8 At2g23950.1 68415.m02860 leucine-rich repeat family protein / pr... 29 2.8 At1g78230.1 68414.m09116 leucine-rich repeat family protein 29 2.8 At5g20480.1 68418.m02434 leucine-rich repeat transmembrane prote... 29 3.7 At5g10020.1 68418.m01161 leucine-rich repeat transmembrane prote... 29 3.7 At3g24954.1 68416.m03124 leucine-rich repeat family protein cont... 29 3.7 At2g32660.1 68415.m03992 disease resistance family protein / LRR... 29 3.7 At1g75640.1 68414.m08788 leucine-rich repeat family protein / pr... 29 3.7 At5g61480.1 68418.m07714 leucine-rich repeat transmembrane prote... 28 4.9 At5g40170.1 68418.m04875 disease resistance family protein conta... 28 4.9 At5g14210.1 68418.m01660 leucine-rich repeat transmembrane prote... 28 4.9 At2g24230.1 68415.m02894 leucine-rich repeat transmembrane prote... 28 4.9 At1g68780.1 68414.m07862 leucine-rich repeat family protein cont... 28 4.9 At1g53730.1 68414.m06114 leucine-rich repeat transmembrane prote... 28 4.9 At5g47250.1 68418.m05826 disease resistance protein (CC-NBS-LRR ... 28 6.4 At5g45770.1 68418.m05627 leucine-rich repeat family protein cont... 28 6.4 At4g28490.1 68417.m04076 leucine-rich repeat transmembrane prote... 28 6.4 At3g26500.1 68416.m03305 leucine-rich repeat family protein 28 6.4 At3g23110.1 68416.m02913 disease resistance family protein conta... 28 6.4 At3g14350.3 68416.m01816 leucine-rich repeat transmembrane prote... 28 6.4 At3g14350.2 68416.m01814 leucine-rich repeat transmembrane prote... 28 6.4 At3g14350.1 68416.m01815 leucine-rich repeat transmembrane prote... 28 6.4 At3g11010.1 68416.m01329 disease resistance family protein / LRR... 28 6.4 At1g71390.1 68414.m08243 disease resistance family protein / LRR... 28 6.4 At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, put... 28 6.4 At1g33610.1 68414.m04160 leucine-rich repeat family protein cont... 28 6.4 At1g13230.1 68414.m01535 leucine-rich repeat family protein cont... 28 6.4 At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, put... 27 8.5 At5g58150.1 68418.m07278 leucine-rich repeat transmembrane prote... 27 8.5 At5g53890.1 68418.m06703 leucine-rich repeat transmembrane prote... 27 8.5 At5g27060.1 68418.m03229 disease resistance family protein conta... 27 8.5 At5g25910.1 68418.m03077 disease resistance family protein conta... 27 8.5 At5g06940.1 68418.m00784 leucine-rich repeat family protein cont... 27 8.5 At2g32680.1 68415.m03995 disease resistance family protein conta... 27 8.5 At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put... 27 8.5 At2g25790.1 68415.m03095 leucine-rich repeat transmembrane prote... 27 8.5 At1g54480.1 68414.m06214 leucine-rich repeat family protein cont... 27 8.5 >At4g04220.1 68417.m00598 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 811 Score = 40.7 bits (91), Expect = 9e-04 Identities = 28/81 (34%), Positives = 49/81 (60%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEEL 519 K+ G++P T+L L+ L+ LNL+NN+ + F L K+E++DLSHN ++ E+ Sbjct: 653 KLHGEIP-TSLGNLK---SLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTG--EI 706 Query: 520 FRFETRPYKLNKLVLANNNIE 582 + ++ +LN L L NN ++ Sbjct: 707 PKTLSKLSELNTLDLRNNKLK 727 >At2g17440.1 68415.m02012 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeats Length = 526 Score = 40.3 bits (90), Expect = 0.001 Identities = 32/81 (39%), Positives = 43/81 (53%) Frame = +1 Query: 349 GQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRF 528 GQ+P++ LL L +LNL+ NQ+ + S F L LE +DLS N +S L E Sbjct: 266 GQLPESIGDLLN----LVNLNLSGNQLSSLPSS-FNRLIHLEELDLSSNSLSILPESIGS 320 Query: 529 ETRPYKLNKLVLANNNIEELP 591 L KL + NNIEE+P Sbjct: 321 LV---SLKKLDVETNNIEEIP 338 Score = 31.9 bits (69), Expect = 0.39 Identities = 41/159 (25%), Positives = 63/159 (39%), Gaps = 1/159 (0%) Frame = +1 Query: 124 VACNCPRENIHSLGQCAFKIECTTNVRGIRLPNECLEAANFPVTVTVTLKNVAEDYYPGD 303 V N E HS+ C+ E + ++ E + + +TV N+ + Sbjct: 329 VETNNIEEIPHSISGCSSMEELRADYNRLKALPEAVGKLSTLEILTVRYNNIRQLPTTMS 388 Query: 304 PETRLLGFITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIE-RIAGSPFYYLGKLETI 480 L S +P++ L Y L LN+ NN R L KLE + Sbjct: 389 SMANLKELDVSFNELESVPES----LCYAKTLVKLNIGNNFANLRSLPGLIGNLEKLEEL 444 Query: 481 DLSHNRISDLEELFRFETRPYKLNKLVLANNNIEELPQD 597 D+S+N+I L + F+T L L N +EELP+D Sbjct: 445 DMSNNQIRFLP--YSFKTLS-NLRVLQTEQNPLEELPRD 480 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 38.3 bits (85), Expect = 0.005 Identities = 25/65 (38%), Positives = 38/65 (58%) Frame = +1 Query: 385 YTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVL 564 Y RL L + NN+I RI + +L KL ++ L++NR+ +L E+ + P KL L L Sbjct: 62 YLNRLGTLLINNNRITRINPNLGEFLPKLHSLVLTNNRLVNLVEIDPLASIP-KLQYLSL 120 Query: 565 ANNNI 579 +NNI Sbjct: 121 LDNNI 125 >At5g49290.1 68418.m06100 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 888 Score = 37.5 bits (83), Expect = 0.008 Identities = 27/73 (36%), Positives = 37/73 (50%) Frame = +1 Query: 358 PKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETR 537 P TNLT L+ ++L L L +E+I Y L +DLS NRIS + + E Sbjct: 288 PLTNLTKLKPLFQLSVLVLRLCSLEKIPNF-LMYQKNLHVVDLSGNRISGIIPTWLLENN 346 Query: 538 PYKLNKLVLANNN 576 P +L L L NN+ Sbjct: 347 P-ELEVLQLKNNS 358 >At1g61300.1 68414.m06909 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 762 Score = 37.1 bits (82), Expect = 0.010 Identities = 23/65 (35%), Positives = 37/65 (56%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L L +NQ++ ++G Y+ KL +DLS+NR D +L + L L L+N + Sbjct: 424 LTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNR--DFNKLPEQISGLVSLQFLDLSNTS 481 Query: 577 IEELP 591 I++LP Sbjct: 482 IKQLP 486 >At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 967 Score = 36.3 bits (80), Expect = 0.018 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L L +NQ++ ++G Y+ KL +DLSHN D EL + L L L+ Sbjct: 539 LTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSHN--PDFNELPEQISGLVSLQYLDLSWTR 596 Query: 577 IEELP 591 IE+LP Sbjct: 597 IEQLP 601 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 35.9 bits (79), Expect = 0.024 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 2/93 (2%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 ++S +TG +P L RL L NN ++ + +L+ IDLSHN++S Sbjct: 352 LSSNSLTGTLPGQTSQFL----RLTSLKAANNSLQGVLPFILGTYPELKEIDLSHNQLSG 407 Query: 508 LEELFRFETRPYKLNKLVLANNNIE-ELP-QDA 600 + F + KL +L L+NNN LP QDA Sbjct: 408 VIPSNLFISA--KLTELNLSNNNFSGSLPLQDA 438 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/61 (34%), Positives = 36/61 (59%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L+ LNL++N R++GS +G IDLS+N+IS EL R + + + L++N+ Sbjct: 302 LEKLNLSSN---RLSGSLPLKVGHCAIIDLSNNKISG--ELSRIQNWGDSVEIIRLSSNS 356 Query: 577 I 579 + Sbjct: 357 L 357 >At1g61310.1 68414.m06910 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 925 Score = 35.5 bits (78), Expect = 0.032 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L L +NQ++ ++G Y+ KL +DLS NR D EL + L L L+ Sbjct: 548 LTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNR--DFNELPEQISGLVSLQYLDLSFTR 605 Query: 577 IEELP 591 IE+LP Sbjct: 606 IEQLP 610 >At4g20140.1 68417.m02947 leucine-rich repeat transmembrane protein kinase, putative Cf-2.2, Lycopersicon pimpinellifolium, PIR:T10515 Length = 1249 Score = 35.1 bits (77), Expect = 0.042 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +1 Query: 343 ITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS-DLEEL 519 +TG++P L +LQ L+L NQ++ + LG L+T+DLS N ++ ++ E Sbjct: 251 LTGEIPSQ----LGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEE 306 Query: 520 FRFETRPYKLNKLVLANNNIE-ELPQ 594 F +L LVLANN++ LP+ Sbjct: 307 F---WNMSQLLDLVLANNHLSGSLPK 329 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 406 LNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+L+ N S L KLET+DLSHN+++ Sbjct: 773 LDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLT 805 >At1g61180.1 68414.m06894 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 889 Score = 35.1 bits (77), Expect = 0.042 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L L +N+++ + G+ Y+ KL +DLS+NR D +L + L L L+N + Sbjct: 535 LTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNR--DFNKLPEQISGLVSLQFLDLSNTS 592 Query: 577 IEELP 591 IE +P Sbjct: 593 IEHMP 597 >At1g34420.1 68414.m04275 leucine-rich repeat family protein / protein kinase family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 966 Score = 35.1 bits (77), Expect = 0.042 Identities = 21/58 (36%), Positives = 32/58 (55%) Frame = +1 Query: 406 LNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNNI 579 LNL+ N E + L +LE +DLS+N S E+ F +R L +L+L+NN + Sbjct: 515 LNLSYNLFEGSIPTTLSELDRLEVLDLSNNNFSG--EIPNFLSRLMSLTQLILSNNQL 570 >At5g44700.1 68418.m05477 leucine-rich repeat transmembrane protein kinase, putative Length = 1252 Score = 34.3 bits (75), Expect = 0.074 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL--EELFRFETRPYKLNKLVLAN 570 +Q LNL NQ++ + L L+T+DLS N ++ + EE +R +L LVLA Sbjct: 266 IQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMN----QLEFLVLAK 321 Query: 571 NNIE-ELPQ 594 N + LP+ Sbjct: 322 NRLSGSLPK 330 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 343 ITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +TGQ+P + L++ T +L L NN +E S L L+ L HN + Sbjct: 373 LTGQIPDSLFQLVELT----NLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNL 421 Score = 28.7 bits (61), Expect = 3.7 Identities = 21/53 (39%), Positives = 30/53 (56%) Frame = +1 Query: 343 ITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +TG++P + LQ DL+ NN RI S L KLE++DLSHN++ Sbjct: 756 LTGEIP-VEIGQLQDLQSALDLSY-NNFTGRIP-STISTLPKLESLDLSHNQL 805 >At5g01890.1 68418.m00108 leucine-rich repeat transmembrane protein kinase, putative leucine-rich receptor-like protein (LRPKm1) - Malus domestica, EMBL:AF053127 Length = 967 Score = 34.3 bits (75), Expect = 0.074 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHN 495 K+TG +P + L Y L LNL++NQ+ ++L L+++D SHN Sbjct: 152 KLTGSIPVS----LSYCSTLTHLNLSSNQLSGRLPRDIWFLKSLKSLDFSHN 199 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L L+NN + F +LG L+ +D S N +S FE + L + LANN Sbjct: 94 LHTLVLSNNNLTGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFE-QCGSLRSVSLANNK 152 Query: 577 I 579 + Sbjct: 153 L 153 Score = 28.3 bits (60), Expect = 4.9 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS-DLEE 516 +++GQ+P + L +NL+ N++ L LE IDLS N +S L + Sbjct: 468 RLSGQIPAK----ISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPK 523 Query: 517 LFRFETRPYKLNKLVLANNNIEELPQDAF 603 E + L + NN ELP F Sbjct: 524 --EIEKLSHLLTFNISHNNITGELPAGGF 550 >At4g20940.1 68417.m03034 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 977 Score = 34.3 bits (75), Expect = 0.074 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 ++ LNL++NQ+E S F L+ +DLS+N +S EL F Y L L L+NN Sbjct: 249 IKHLNLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSG--ELPGF-NYVYDLEVLKLSNNR 305 Query: 577 IE-ELPQD 597 LP + Sbjct: 306 FSGSLPNN 313 >At4g08850.2 68417.m01455 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1009 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +LQ L+L+ NQ++ S F L LE +DLSHN +S Sbjct: 599 QLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLS 635 Score = 31.5 bits (68), Expect = 0.52 Identities = 23/84 (27%), Positives = 46/84 (54%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 ++S + + ++P T L RL +NL+ N +++ L +L+ +DLS+N++ D Sbjct: 557 LSSNRFSSEIPPT----LNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQL-D 611 Query: 508 LEELFRFETRPYKLNKLVLANNNI 579 E +F + L +L L++NN+ Sbjct: 612 GEISSQFRSL-QNLERLDLSHNNL 634 >At4g08850.1 68417.m01454 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1045 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +LQ L+L+ NQ++ S F L LE +DLSHN +S Sbjct: 599 QLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLS 635 Score = 31.5 bits (68), Expect = 0.52 Identities = 23/84 (27%), Positives = 46/84 (54%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 ++S + + ++P T L RL +NL+ N +++ L +L+ +DLS+N++ D Sbjct: 557 LSSNRFSSEIPPT----LNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQL-D 611 Query: 508 LEELFRFETRPYKLNKLVLANNNI 579 E +F + L +L L++NN+ Sbjct: 612 GEISSQFRSL-QNLERLDLSHNNL 634 >At2g41820.1 68415.m05168 leucine-rich repeat transmembrane protein kinase, putative Length = 890 Score = 33.9 bits (74), Expect = 0.098 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 325 FITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNR 498 F+ L ++G + N+TL+ L+ L+L+ N + F L +LE +DLS NR Sbjct: 64 FVEMLDLSGLQLRGNVTLISDLRSLKHLDLSGNNFNGRIPTSFGNLSELEFLDLSLNR 121 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 33.9 bits (74), Expect = 0.098 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +1 Query: 343 ITGQMPKTNL-----TLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +T +P +NL + L + LQ LNL+NN + F+ KL +DLS+N IS Sbjct: 78 VTLSLPNSNLVGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFFAADKLRFLDLSNNLIS 136 >At1g71400.1 68414.m08246 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 847 Score = 33.9 bits (74), Expect = 0.098 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 KI G +P++ L Y L+ LNL+ N + L KLET+D+S N++S Sbjct: 669 KINGNIPES----LGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLS 719 >At5g59670.1 68418.m07481 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 868 Score = 33.1 bits (72), Expect = 0.17 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 R+ LNL+++++ + + +LET+DLS+N ++ E+ F + L+ + L+ N Sbjct: 411 RITSLNLSSSRLNGTIAAAIQSITQLETLDLSYNNLTG--EVPEFLGKMKSLSVINLSGN 468 Query: 574 NIE-ELPQ 594 N+ +PQ Sbjct: 469 NLNGSIPQ 476 >At3g13380.1 68416.m01683 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1164 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 6/78 (7%) Frame = +1 Query: 364 TNLTLLQYTY----RLQDLNLTNNQIE-RIAGSPFYYLGKLETIDLSHNRISD-LEELFR 525 T+ +++ Y + L +N ++N++ ++ SP ++ T+DLS+NR SD + E F Sbjct: 137 TDSSIVDYVFSTCLNLVSVNFSHNKLAGKLKSSPSASNKRITTVDLSNNRFSDEIPETF- 195 Query: 526 FETRPYKLNKLVLANNNI 579 P L L L+ NN+ Sbjct: 196 IADFPNSLKHLDLSGNNV 213 >At2g33050.1 68415.m04053 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 800 Score = 33.1 bits (72), Expect = 0.17 Identities = 26/84 (30%), Positives = 43/84 (51%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 + S TGQ+P + L+ T+ LNL++N++ + P L KL +DLS+N+ S Sbjct: 122 LASSSFTGQVPSSISNLILLTH----LNLSHNELTG-SFPPVRNLTKLSFLDLSYNQFSG 176 Query: 508 LEELFRFETRPYKLNKLVLANNNI 579 T P+ L+ L L N++ Sbjct: 177 AIPFDLLPTLPF-LSYLDLKKNHL 199 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L+ +NL N +E F+ K +T+D+ +NR++ +L + L L + NN Sbjct: 426 LKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTG--KLPKSLLNCSSLRFLSVDNNR 483 Query: 577 IEE 585 IE+ Sbjct: 484 IED 486 >At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, putative (ERECTA) identical to uncharacterized receptor protein kinase ERECTA [Arabidopsis thaliana] gi|1389566|dbj|BAA11869; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 976 Score = 33.1 bits (72), Expect = 0.17 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL 510 K +G +P+ L TY LNL++N I+ +G L+T+DLS+N+I+ + Sbjct: 390 KFSGTIPRAFQKLESMTY----LNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGI 442 Score = 27.5 bits (58), Expect = 8.5 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 +++ KI G +P ++L L++ L +NL+ N I + F L + IDLS+N IS Sbjct: 434 LSNNKINGIIP-SSLGDLEH---LLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISG 489 Query: 508 --LEELFRFETRPYKLNKLVLANNNI 579 EEL + + + L L NNN+ Sbjct: 490 PIPEELNQLQ----NIILLRLENNNL 511 >At5g66330.1 68418.m08363 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5B [Lycopersicon esculentum] gi|3894391|gb|AAC78595 Length = 418 Score = 32.3 bits (70), Expect = 0.30 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +1 Query: 406 LNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNNIEE 585 +++ NN + F L LE IDLSHN++S F F + L +L L+ N Sbjct: 226 ISMRNNLFQGTIPESFKLLNSLEVIDLSHNKLSGSIPSFIFTHQ--SLQQLTLSFNGFTS 283 Query: 586 L 588 L Sbjct: 284 L 284 >At5g45780.1 68418.m05630 leucine-rich repeat transmembrane protein kinase, putative Length = 614 Score = 32.3 bits (70), Expect = 0.30 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +1 Query: 322 GFITSLKITGQMPKTNL-TLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNR 498 GF+ SL++ + L T + L L L NNQ+ S L +LET+DLS NR Sbjct: 79 GFVVSLEMASKGLSGILSTSIGELTHLHTLLLQNNQLTGPIPSELGQLSELETLDLSGNR 138 Query: 499 IS 504 S Sbjct: 139 FS 140 >At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, putative / extra sporogenous cells (ESP) identical to extra sporogenous cells [Arabidopsis thaliana] gi|23304947|emb|CAD42912; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1192 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +1 Query: 343 ITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +TG +PK + + +LQ LNL NNQ+ F LG L ++L+ N++ Sbjct: 640 LTGSIPKE----MGNSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKL 688 >At3g17640.1 68416.m02253 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 396 Score = 32.3 bits (70), Expect = 0.30 Identities = 22/60 (36%), Positives = 34/60 (56%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L+ ++LT N++ F L L T+DLS+N++S L F T +L LVLA+N+ Sbjct: 116 LRVISLTRNRLTGPIPVSFSSLSNLHTLDLSYNQLSG--SLPPFLTTLPRLKVLVLASNH 173 >At1g74360.1 68414.m08615 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive 1 GB:AAC49810 (putative receptor protein kinase); contains Pfam profiles: PF00560 Leucine Rich Repeat (17 repeats), PF00069 Eukaryotic protein kinase domain Length = 1106 Score = 32.3 bits (70), Expect = 0.30 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 4/96 (4%) Frame = +1 Query: 379 LQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS-DLEELFRFETRPYKLNK 555 L + L+ LNL++N +E P L LE +DLS NRI+ D++ F P N Sbjct: 131 LSRCHNLKHLNLSHNILEGELSLPG--LSNLEVLDLSLNRITGDIQSSF-----PLFCNS 183 Query: 556 LVLAN---NNIEELPQDAFXXXXXXXXXXXXYNRIS 654 LV+AN NN D F NR S Sbjct: 184 LVVANLSTNNFTGRIDDIFNGCRNLKYVDFSSNRFS 219 >At5g37450.1 68418.m04507 leucine-rich repeat transmembrane protein kinase, putative Length = 935 Score = 31.9 bits (69), Expect = 0.39 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 3/107 (2%) Frame = +1 Query: 193 TNVRGIRLPNECLEAANFPVTVTVTLKNV-AEDYYPGDPETRLLGF--ITSLKITGQMPK 363 +N G +P+ + P V ++L+N E P ++ +L + I+S K+TG++PK Sbjct: 183 SNFDGTEIPSSY---GSIPNLVKLSLRNCNLEGPIPDLSKSLVLYYLDISSNKLTGEIPK 239 Query: 364 TNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +++ + +NL NN + S F L +L+ + + +N +S Sbjct: 240 N-----KFSANITTINLYNNLLSGSIPSNFSGLPRLQRLQVQNNNLS 281 >At5g06970.1 68418.m00789 expressed protein Length = 1101 Score = 31.9 bits (69), Expect = 0.39 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 17 LRRICCASHTEFRSERTVLRWRK 85 L +CC S TEF ++ LRW+K Sbjct: 298 LELLCCVSRTEFSDKKAYLRWQK 320 >At3g25560.1 68416.m03178 protein kinase family protein contains Prosite:PS00108: Serine/Threonine protein kinases active-site signature and PS00107: Protein kinases ATP-binding region signature Length = 635 Score = 31.9 bits (69), Expect = 0.39 Identities = 19/59 (32%), Positives = 31/59 (52%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +++ TGQ+P T L Y+ LQ L + NN + S + +L +DLS+N +S Sbjct: 136 LSTNNFTGQIPFT----LSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLSYNNLS 190 >At2g34930.1 68415.m04288 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 905 Score = 31.9 bits (69), Expect = 0.39 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +1 Query: 343 ITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 I+G++P+ L LL L+ LNL+ N + L +LET+DLS N+ S Sbjct: 797 ISGEIPREILGLLY----LRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFS 846 >At2g33060.1 68415.m04054 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 808 Score = 31.9 bits (69), Expect = 0.39 Identities = 15/47 (31%), Positives = 30/47 (63%) Frame = +1 Query: 373 TLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLE 513 T+L+ +L+ ++L+NN+I+ F+ L +L ++L +N +DLE Sbjct: 309 TILKNLTKLEHIDLSNNKIKGKVPEWFWNLPRLRRVNLFNNLFTDLE 355 Score = 30.7 bits (66), Expect = 0.91 Identities = 23/61 (37%), Positives = 32/61 (52%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 RL+ L L++N S F L +L +DLSHN +L F F KL+ LVL+ N Sbjct: 123 RLEVLYLSSNGFLGQVPSSFSNLSQLNILDLSHN---ELTGSFPFVQNLTKLSILVLSYN 179 Query: 574 N 576 + Sbjct: 180 H 180 >At1g55610.1 68414.m06365 protein kinase family protein contains Prosite:PS00107: Protein kinases ATP-binding region signature Length = 1166 Score = 31.9 bits (69), Expect = 0.39 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD-LEELFRFETRPYKLNKLVLANN 573 L +N++NN++ G L L T+DLS+N +SD + E F P L L L +N Sbjct: 153 LVSVNISNNKLVGKLGFAPSSLQSLTTVDLSYNILSDKIPESF-ISDFPASLKYLDLTHN 211 Query: 574 NI 579 N+ Sbjct: 212 NL 213 >At1g35710.1 68414.m04439 leucine-rich repeat transmembrane protein kinase, putative similar to many predicted protein kinases Length = 1120 Score = 31.9 bits (69), Expect = 0.39 Identities = 21/63 (33%), Positives = 34/63 (53%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 +L L+L++NQ++ S L L+ +DLSHN +S L FE L + ++NN Sbjct: 678 QLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPT-TFEGM-IALTNVDISNN 735 Query: 574 NIE 582 +E Sbjct: 736 KLE 738 >At1g58190.1 68414.m06605 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1784 Score = 31.5 bits (68), Expect = 0.52 Identities = 20/56 (35%), Positives = 34/56 (60%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHN 495 ++S +++G +PK L LQ R++ LNL++N + + F L +E+IDLS N Sbjct: 1604 LSSNELSGDIPK-ELGDLQ---RIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFN 1655 Score = 31.1 bits (67), Expect = 0.69 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +1 Query: 286 DYYPGDPETRLLGF-ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYL 462 D Y G+ + G +S ++ G++P+ L R++ LNL++N + + F L Sbjct: 738 DSYMGESFKFMFGLDFSSNELIGEIPRE----LGDFQRIRALNLSHNSLSGLVPESFSNL 793 Query: 463 GKLETIDLSHN 495 +E+IDLS N Sbjct: 794 TDIESIDLSFN 804 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 ++ LNL+NN + I S F + ++ +DLSHN S Sbjct: 1274 IRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHNNFS 1309 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 + LNL+NN + S F + K+ +DLSHN +S Sbjct: 421 ISHLNLSNNGFQGNLPSSFSEMKKIFFLDLSHNNLS 456 >At1g47890.1 68414.m05333 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1019 Score = 31.5 bits (68), Expect = 0.52 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +++ + G +P TL+ L DL+L NN + F KL ++D+SHNR+ Sbjct: 642 LSNNNLNGSLPWCLETLMS---SLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRM 696 >At2g15080.2 68415.m01719 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 983 Score = 31.1 bits (67), Expect = 0.69 Identities = 20/55 (36%), Positives = 32/55 (58%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 K G++PK+ + LL+ L LNL+NN + S L LE++D+S N++S Sbjct: 805 KFEGEIPKS-IGLLK---ELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLS 855 >At2g15080.1 68415.m01718 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 983 Score = 31.1 bits (67), Expect = 0.69 Identities = 20/55 (36%), Positives = 32/55 (58%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 K G++PK+ + LL+ L LNL+NN + S L LE++D+S N++S Sbjct: 805 KFEGEIPKS-IGLLK---ELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLS 855 >At1g78980.1 68414.m09209 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 2 GI:3360291 from [Zea mays] Length = 693 Score = 31.1 bits (67), Expect = 0.69 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 LQ +NL N++ F L KLET+D S N++S Sbjct: 140 LQSINLGQNKLNGELPDMFQKLSKLETLDFSLNKLS 175 >At4g30520.1 68417.m04333 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 648 Score = 30.7 bits (66), Expect = 0.91 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+ ++L NN I +L KL+T+DLS+NR S Sbjct: 103 LRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFS 138 >At3g46330.1 68416.m05017 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 878 Score = 30.7 bits (66), Expect = 0.91 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +1 Query: 367 NLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL 510 N+T + R+ LNL+++ + S F L LE++DLS+N +S + Sbjct: 404 NITDISAPPRIISLNLSSSGLSGTIVSNFQNLAHLESLDLSNNSLSGI 451 >At3g25670.1 68416.m03195 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; + Length = 475 Score = 30.7 bits (66), Expect = 0.91 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 L L+L+NNQ+E +L L +DL +NRIS LF + L LVL+ N Sbjct: 237 LLKLDLSNNQLEGRLPQEIGFLKNLTLLDLRNNRISG--GLFENIEKIPSLTDLVLSGN 293 >At3g20820.1 68416.m02633 leucine-rich repeat family protein contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779; contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 365 Score = 30.7 bits (66), Expect = 0.91 Identities = 18/55 (32%), Positives = 31/55 (56%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +ITG++P++ L YRL D++L+ NQ+ + L T++L N+IS Sbjct: 210 RITGRIPES----LTNIYRLADVDLSGNQLYGTIPPSLGRMSVLATLNLDGNKIS 260 >At3g13065.1 68416.m01632 leucine-rich repeat transmembrane protein kinase, putative leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 646 Score = 30.7 bits (66), Expect = 0.91 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 5/71 (7%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS-----DLEELFRFETRPYKLNKLV 561 L LNL N + F L KLETIDLS N+++ L +T + N+ Sbjct: 102 LSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFK 161 Query: 562 LANNNIEELPQ 594 + N + +LPQ Sbjct: 162 GSINALRDLPQ 172 >At3g11080.1 68416.m01339 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 943 Score = 30.7 bits (66), Expect = 0.91 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 1/90 (1%) Frame = +1 Query: 310 TRLLGFITSL-KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDL 486 TRL + S + TG +P N++LL L D +NN S + + L +DL Sbjct: 293 TRLSALLLSHNQFTGTIPN-NISLLS---NLMDFEASNNAFTGTLPSSLFNIPPLIRLDL 348 Query: 487 SHNRISDLEELFRFETRPYKLNKLVLANNN 576 S N+++ F + P L L++ +NN Sbjct: 349 SDNQLNGTLH-FGNISSPSNLQYLIIGSNN 377 >At3g05650.1 68416.m00629 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4A protein [Lycopersicon esculentum] gi|3097197|emb|CAA73187 Length = 868 Score = 30.7 bits (66), Expect = 0.91 Identities = 30/111 (27%), Positives = 57/111 (51%), Gaps = 4/111 (3%) Frame = +1 Query: 256 VTVTLKNVAEDYYPGDPETRLLGFITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIER 435 V+ T K D++P ++L +++ IT + P+ LL+ +++ +L+++NN+I+ Sbjct: 375 VSATTKISVADHHPTQLISQL--YLSGCGIT-EFPE----LLRSQHKMTNLDISNNKIKG 427 Query: 436 IAGSPFYYLGKLETIDLSHNRISDLEEL----FRFETRPYKLNKLVLANNN 576 + L KL +DLS+N + E T+P + LV +NNN Sbjct: 428 QVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKP-SMQYLVGSNNN 477 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/59 (30%), Positives = 31/59 (52%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 L+ L++ +NQ+ F L LE +++ +NRI+D + + KL LVL +N Sbjct: 539 LRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLK--KLQVLVLRSN 595 >At1g49360.1 68414.m05533 F-box family protein contains Pfam PF00646: F-box domain Length = 481 Score = 30.7 bits (66), Expect = 0.91 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 412 LTNNQIERIAGSPFYYLGKLETIDLSHNRISD-LEELFRFETRPYKLNKLVLANNNI 579 L N+ + IA F+ E IDL NRI + + F F P K + LV NNI Sbjct: 201 LMNDSLSLIADMYFFNPFTRERIDLPRNRIMESVHTNFAFSCAPTKKSCLVFGINNI 257 >At1g07390.1 68414.m00788 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 976 Score = 30.7 bits (66), Expect = 0.91 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%) Frame = +1 Query: 247 PVTVTVTLKNVAEDYYPGDPETRLLGF-ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNN 423 P TV L + Y GD + G ++S +++G++P + LQ ++ LNL++N Sbjct: 788 PATVVDFLTKSRYEAYQGDILRYMHGLDLSSNELSGEIP-IEIGDLQ---NIRSLNLSSN 843 Query: 424 QIERIAGSPFYYLGKLETIDLSHNRI 501 ++ L LE++DLS+N++ Sbjct: 844 RLTGSIPDSISKLKGLESLDLSNNKL 869 Score = 29.9 bits (64), Expect = 1.6 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 5/82 (6%) Frame = +1 Query: 352 QMPKTNLTLLQYTYRLQDLNLTNNQIERIAG-----SPFYYLGKLETIDLSHNRISDLEE 516 Q NL+LL +LQ LNL+ N ++ F L KL T+D SHN + Sbjct: 69 QTRSLNLSLLHSFPQLQSLNLSWNWFTNLSDHFLGFKSFGTLDKLTTLDFSHNMFDN--S 126 Query: 517 LFRFETRPYKLNKLVLANNNIE 582 + F + L L +N +E Sbjct: 127 IVPFLNAATSIRSLHLESNYME 148 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L++L L NN+ + + LE +DL +N S ++ + KL L+L NN+ Sbjct: 647 LRELRLQNNEFTGLVPGNLFKAAGLEVLDLRNNNFSG--KILNTIDQTSKLRILLLRNNS 704 Query: 577 IE 582 + Sbjct: 705 FQ 706 Score = 27.9 bits (59), Expect = 6.4 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L+ LNL +N ++ LE +DLS N ++D E T KL L L N Sbjct: 162 LRVLNLKDNSFSFLSSQGLTDFRDLEVLDLSFNGVNDSEASHSLSTA--KLKTLDLNFNP 219 Query: 577 IEELPQ 594 + + Q Sbjct: 220 LSDFSQ 225 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFET 534 L+ L+L+ N + S KL+T+DL+ N +SD +L E+ Sbjct: 186 LEVLDLSFNGVNDSEASHSLSTAKLKTLDLNFNPLSDFSQLKGLES 231 >At1g74190.1 68414.m08592 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 965 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = +1 Query: 286 DYYPGDPETRLLGF-ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYL 462 D Y G L G ++ +++G++P LL+ L+ LNL++N + + + Sbjct: 771 DAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLE----LRALNLSHNNLSGVIPKSISSM 826 Query: 463 GKLETIDLSHNRI 501 K+E+ DLS NR+ Sbjct: 827 EKMESFDLSFNRL 839 >At1g74170.1 68414.m08590 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1068 Score = 30.3 bits (65), Expect = 1.2 Identities = 26/90 (28%), Positives = 46/90 (51%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 I++ K+TG +P + Q + LQ L+NN +E + + + L+ +DLS NR+S Sbjct: 624 ISNNKLTGVIPSW-IGERQGLFALQ---LSNNMLEGEIPTSLFNISYLQLLDLSSNRLSG 679 Query: 508 LEELFRFETRPYKLNKLVLANNNIEELPQD 597 ++ + Y L+L NNN+ + D Sbjct: 680 --DIPPHVSSIYHGAVLLLQNNNLSGVIPD 707 Score = 29.9 bits (64), Expect = 1.6 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +1 Query: 286 DYYPGDPETRLLGF-ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYL 462 D Y G L G ++ +++G++P L++ L+ LNL++N + + F L Sbjct: 839 DAYMGGNLKLLFGMDLSENELSGEIPVELGGLVE----LEALNLSHNNLSGVILESFSGL 894 Query: 463 GKLETIDLSHNRI 501 +E++DLS NR+ Sbjct: 895 KNVESLDLSFNRL 907 >At3g53240.1 68416.m05868 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 891 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 1/90 (1%) Frame = +1 Query: 235 AANFPVTVTVTLKNVAEDYYPGDPETRLLGF-ITSLKITGQMPKTNLTLLQYTYRLQDLN 411 + +F V V +K D Y ++ G ++S +++G +P+ L R++ LN Sbjct: 678 SVDFNVQVEFAVKQ-RYDLYMRGTLNQMFGLDLSSNELSGNIPEE----LGDLKRVRSLN 732 Query: 412 LTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 L+ N + F L +E++DLS N++ Sbjct: 733 LSRNSLSGSIPGSFSNLRSIESLDLSFNKL 762 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 5/61 (8%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQI-----ERIAGSPFYYLGKLETIDLSH 492 + S++ +P+ NLT LQ LNL++ ER G L LET+DL Sbjct: 29 LESIRPPDPLPQLNLTFFYPFEELQSLNLSSGYFKGWFDERKGGKGLGSLRNLETLDLGV 88 Query: 493 N 495 N Sbjct: 89 N 89 >At3g05370.1 68416.m00586 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2 disease resistance protein GB:AAC15780 from [Lycopersicon pimpinellifolium] Length = 860 Score = 29.9 bits (64), Expect = 1.6 Identities = 24/89 (26%), Positives = 47/89 (52%) Frame = +1 Query: 238 ANFPVTVTVTLKNVAEDYYPGDPETRLLGFITSLKITGQMPKTNLTLLQYTYRLQDLNLT 417 A F ++ + K V ++ + E +++ F + + +G +P++ + LL+ L+ LNL+ Sbjct: 645 AFFVDSMEIVNKGVETEFKRINEENKVINF-SGNRFSGNIPES-IGLLK---ELRHLNLS 699 Query: 418 NNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +N L KLE +DLS N++S Sbjct: 700 SNAFTGNIPQSLANLMKLEALDLSLNQLS 728 >At2g29000.1 68415.m03527 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 872 Score = 29.9 bits (64), Expect = 1.6 Identities = 21/65 (32%), Positives = 35/65 (53%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 R+ L+L+N ++ I L +LE +DLS NR+S E+ F L+ + L+ N Sbjct: 407 RIISLDLSNRGLKGIIEPVLQNLTQLEKLDLSINRLSG--EVPEFLANMKSLSNINLSWN 464 Query: 574 NIEEL 588 N++ L Sbjct: 465 NLKGL 469 >At1g12970.1 68414.m01506 leucine-rich repeat family protein Length = 464 Score = 29.9 bits (64), Expect = 1.6 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +1 Query: 397 LQDLNLTNNQIERIA-GSPFYYLGKLETIDLSHNRISDL-EELFRFETRPYKLNKLVLAN 570 L+ +NL++N + I L L +DLS+N+I L + FR E KL KL L Sbjct: 325 LEVMNLSSNFSDLIELPDTISDLANLRELDLSNNQIRVLPDSFFRLE----KLEKLNLDQ 380 Query: 571 NNIEELPQD 597 N +E PQ+ Sbjct: 381 NPLEYPPQE 389 >At5g07910.1 68418.m00914 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 262 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/41 (31%), Positives = 27/41 (65%) Frame = +1 Query: 469 LETIDLSHNRISDLEELFRFETRPYKLNKLVLANNNIEELP 591 + T+DL+HN+I+D+ ++ + +L++A+N +E LP Sbjct: 47 VRTLDLTHNKIADVPGEI---SKLINMQRLLIADNLVERLP 84 >At4g03260.1 68417.m00445 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 677 Score = 29.5 bits (63), Expect = 2.1 Identities = 24/64 (37%), Positives = 30/64 (46%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L LNL+ N I I G L +L +DLS+NRI L L +L LA N Sbjct: 443 LHALNLSKNSISVIEG--LRELTRLRVLDLSYNRILRLGHGL---ASCSSLKELYLAGNK 497 Query: 577 IEEL 588 I E+ Sbjct: 498 ISEI 501 >At2g33020.1 68415.m04047 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 864 Score = 29.5 bits (63), Expect = 2.1 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +1 Query: 391 YRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLAN 570 + L+ LNL N I S F L KLE + LS N S + F + ++ +L L N Sbjct: 183 HSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSG--QCFPTISNLTRITQLYLHN 240 Query: 571 NNI 579 N + Sbjct: 241 NEL 243 Score = 28.7 bits (61), Expect = 3.7 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 7/107 (6%) Frame = +1 Query: 205 GIRLPNECLEAANFPVTVTVTLKNVAEDYYPG---DPETRLLGF----ITSLKITGQMPK 363 G+ + E +AAN PV T T + + Y G + E L + + ++ GQ+P+ Sbjct: 650 GLYMVYEYDKAANSPVRYTYT--DTIDLQYKGLHMEQERVLTSYAAIDFSGNRLQGQIPE 707 Query: 364 TNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 + + LL+ L LNL+NN F L LE++D+S N++S Sbjct: 708 S-IGLLK---ALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLS 750 >At2g01950.1 68415.m00130 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive protein Length = 1143 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+ LNL+ N + F L L+++DLSHNR++ Sbjct: 230 LKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLT 265 Score = 27.9 bits (59), Expect = 6.4 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS-DLEELFRFETRPYKLNKLVLANN 573 L+DL L NNQ+ F+ +E + + NR++ ++ + F +R L L L NN Sbjct: 449 LKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSR---LAVLQLGNN 505 Query: 574 NIE-ELPQD 597 N E+P + Sbjct: 506 NFTGEIPPE 514 >At1g33590.1 68414.m04158 disease resistance protein-related / LRR protein-related contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 477 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD 507 K++G +P L L L+L+ N+ + F L K+ +DLSHN ++D Sbjct: 258 KLSGTIPN----FLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTD 309 >At5g48940.1 68418.m06054 leucine-rich repeat transmembrane protein kinase, putative Length = 1135 Score = 29.1 bits (62), Expect = 2.8 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 +LQ LNL+NN ++ L KL+ +D+S N ++ ++ LN+L+L+ N Sbjct: 516 QLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTG--KIPDSLGHLISLNRLILSKN 573 Query: 574 NIE-ELP 591 + E+P Sbjct: 574 SFNGEIP 580 Score = 28.7 bits (61), Expect = 3.7 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 7/78 (8%) Frame = +1 Query: 319 LGFITSLKITGQMPKTNL--TLLQYTYRLQDL----NLTNNQIERIAGSPFYYLGKLETI 480 LG T+L++ + N+ T+ + + +QDL NL+ N ++ L +L + Sbjct: 583 LGHCTNLQLL-DLSSNNISGTIPEELFDIQDLDIALNLSWNSLDGFIPERISALNRLSVL 641 Query: 481 DLSHNRIS-DLEELFRFE 531 D+SHN +S DL L E Sbjct: 642 DISHNMLSGDLSALSGLE 659 >At3g24240.1 68416.m03042 leucine-rich repeat transmembrane protein kinase, putative similar to CLV1 receptor kinase GB:AAB58929 from [Arabidopsis thaliana] Length = 1141 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 406 LNLTNNQIERIAGSPFYYLGKLETIDLSHNRI-SDLEELFRFE 531 LNL++N++ S L KL +DLSHN + DL L E Sbjct: 616 LNLSSNRLTGKIPSKIASLNKLSILDLSHNMLEGDLAPLANIE 658 >At3g05360.1 68416.m00584 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to elicitor-inducible LRR receptor-like protein EILP [Nicotiana tabacum] gi|6635236|dbj|BAA88636; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 786 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 RL DLNL +N+ + + L +DLSHN + + + ++ L L L+NN Sbjct: 282 RLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNL--VGPIPTSISKLVNLQHLSLSNN 339 Query: 574 NIE-ELP 591 +E E+P Sbjct: 340 TLEGEVP 346 >At2g25470.1 68415.m03050 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 910 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +L+ LNL++N + S F L +E++DLSHN + Sbjct: 746 KLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNML 781 >At2g23950.1 68415.m02860 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 634 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+ ++L NN I L KL+T+DLS+NR S Sbjct: 100 LRQVSLQNNNISGKIPPEICSLPKLQTLDLSNNRFS 135 >At1g78230.1 68414.m09116 leucine-rich repeat family protein Length = 676 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/64 (35%), Positives = 33/64 (51%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L LNL+ N+I I G L +L +DLS+NRIS + + T + +L LA N Sbjct: 470 LHALNLSKNKISVIEG--LRDLTRLRVLDLSYNRISRIGQGLSNCT---LIKELYLAGNK 524 Query: 577 IEEL 588 I + Sbjct: 525 ISNV 528 >At5g20480.1 68418.m02434 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21, Oryza sativa, PIR:A57676 Length = 1031 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 391 YRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +RLQ LN++ N +E S +L T+DLS N + Sbjct: 121 FRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHL 157 >At5g10020.1 68418.m01161 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase ERECTA, Arabidopsis thaliana, EMBL:AC004484 Length = 1048 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 391 YRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI-SDLEELF 522 + L LNL++N+ E S F L +L ++DL N I D+ E+F Sbjct: 147 WSLNHLNLSSNKFEGGFPSGFRNLQQLRSLDLHKNEIWGDVGEIF 191 >At3g24954.1 68416.m03124 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 225 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 ++ G++P++ + LL+ L LNL+NN F L K+E++DLS N++S Sbjct: 54 RLEGEIPES-IGLLK---ALIALNLSNNAFTGHIPLSFANLKKMESLDLSSNQLS 104 >At2g32660.1 68415.m03992 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 589 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 K+ G++P++ + LL+ L LNL+NN F + +LE++DLS N++S Sbjct: 418 KLEGEIPES-IGLLK---TLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLS 468 >At1g75640.1 68414.m08788 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1140 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/69 (28%), Positives = 36/69 (52%) Frame = +1 Query: 298 GDPETRLLGFITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLET 477 G P+ +++ +L + G +P+ +L+ Y LNL++N + +L L+ Sbjct: 528 GLPDLQVVALGNNL-LGGVVPEGFSSLVSLKY----LNLSSNLFSGHIPKNYGFLKSLQV 582 Query: 478 IDLSHNRIS 504 + LSHNRIS Sbjct: 583 LSLSHNRIS 591 >At5g61480.1 68418.m07714 leucine-rich repeat transmembrane protein kinase, putative Length = 1041 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 379 LQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHN 495 ++Y L LNL+ N +E + + L KL T+D+S N Sbjct: 101 IRYLSSLLYLNLSGNSLEGSFPTSIFDLTKLTTLDISRN 139 >At5g40170.1 68418.m04875 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 792 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSP-FYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLAN 570 RL +L+L+ N++ G P + L LE IDLS+N+ S + F T P+ L L L Sbjct: 164 RLTNLDLSYNKLT--GGIPNLHSLTLLENIDLSYNKFSGAIPSYLF-TMPF-LVSLNLRQ 219 Query: 571 NNIEE 585 N++ + Sbjct: 220 NHLSD 224 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 406 LNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+L+NN S L +LE++DLS NRIS Sbjct: 643 LDLSNNSFTGRIPSSLAKLKQLESLDLSQNRIS 675 Score = 27.9 bits (59), Expect = 6.4 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 5/104 (4%) Frame = +1 Query: 208 IRLPNECLEAANFPVTVTVT--LKNVAEDYYP---GDPETRLLGFITSLKITGQMPKTNL 372 +R+ +E P T T N E P GD ++ ++ +++ TG++P + Sbjct: 600 LRIKGRSIELGKIPDTYTSIDFSGNSFEGQIPESIGDLKSLIVLDLSNNSFTGRIPSSLA 659 Query: 373 TLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L Q L+ L+L+ N+I L L +++SHNR++ Sbjct: 660 KLKQ----LESLDLSQNRISGNIPQELRELTFLGYVNMSHNRLT 699 >At5g14210.1 68418.m01660 leucine-rich repeat transmembrane protein kinase, putative Length = 812 Score = 28.3 bits (60), Expect = 4.9 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 3/99 (3%) Frame = +1 Query: 304 PETRLLGFITSLKITGQMPKTNLT-LLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETI 480 P+ L + SL + G ++ L L L+L NN+ + S +G+L + Sbjct: 159 PDISRLVMLQSLMLDGNYFNGSVPDTLDSLTNLTVLSLKNNRFKGPFPSSICRIGRLTNL 218 Query: 481 DLSHNRIS-DLEELFRFETRPYKLNKLVLANNNIE-ELP 591 LSHN IS L +L + L+ L L N+++ ELP Sbjct: 219 ALSHNEISGKLPDLSKLS----HLHMLDLRENHLDSELP 253 >At2g24230.1 68415.m02894 leucine-rich repeat transmembrane protein kinase, putative Length = 853 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L++LNL+ N+I S G+LE +D+S+N S Sbjct: 117 LKNLNLSFNKISGSFSSNVGNFGQLELLDISYNNFS 152 >At1g68780.1 68414.m07862 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 432 Score = 28.3 bits (60), Expect = 4.9 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +1 Query: 391 YRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLAN 570 Y L L+L+NN +E L L +DL +NR+S L + L +LVL+N Sbjct: 243 YSLLKLDLSNNYLEGKLPRELESLKNLTLLDLRNNRLSG--GLSKEIQEMTSLVELVLSN 300 Query: 571 NNI 579 N + Sbjct: 301 NRL 303 >At1g53730.1 68414.m06114 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3360289 from [Zea mays] (Plant Mol. Biol. 37 (5), 749-761 (1998)) Length = 719 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 382 QYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNR 498 Q+ LQ LNL NNQ A + L+ ++L HN+ Sbjct: 115 QFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQ 153 >At5g47250.1 68418.m05826 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 843 Score = 27.9 bits (59), Expect = 6.4 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L L NN++ I G F + L +DLS N + EL + + L L L+ + Sbjct: 536 LVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWN--FQITELPKGISALVSLRLLNLSGTS 593 Query: 577 IEELPQ 594 I+ LP+ Sbjct: 594 IKHLPE 599 >At5g45770.1 68418.m05627 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 425 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/59 (28%), Positives = 34/59 (57%) Frame = +1 Query: 328 ITSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 I++ +TG +PK+ + L+Y ++L+NN ++ L L++++LSHN +S Sbjct: 178 ISNSNLTGLIPKSFHSNLRY------IDLSNNSLKGSIRISITRLKNLKSLNLSHNSLS 230 >At4g28490.1 68417.m04076 leucine-rich repeat transmembrane protein kinase, putative Length = 999 Score = 27.9 bits (59), Expect = 6.4 Identities = 24/80 (30%), Positives = 39/80 (48%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEEL 519 +++G++P+ L+ L +LNL NN + L L +DLS N+ S L Sbjct: 510 QLSGEIPRE----LRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIPL 565 Query: 520 FRFETRPYKLNKLVLANNNI 579 E + KLN L L+ N++ Sbjct: 566 ---ELQNLKLNVLNLSYNHL 582 >At3g26500.1 68416.m03305 leucine-rich repeat family protein Length = 471 Score = 27.9 bits (59), Expect = 6.4 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSP--FYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLA 567 +L+ LNL++N + G P L L +DLS+N+I + + F R KL KL L Sbjct: 323 KLEVLNLSSN-FNNLMGVPDTITDLTNLRELDLSNNQIQAIPDSF---YRLRKLEKLNLD 378 Query: 568 NNNIE 582 N +E Sbjct: 379 QNPLE 383 >At3g23110.1 68416.m02913 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 835 Score = 27.9 bits (59), Expect = 6.4 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 2/133 (1%) Frame = +1 Query: 202 RGIRLP-NECLEAANFPVTVTVTLKNVAEDYYPGDPETRLLGFITSLKITGQMPKTNLTL 378 R I +P + + N ++ + K V D+ +++ F + + +G +P++ + L Sbjct: 613 RNIAIPGSNYMGDDNHQDSIDLVYKGVDTDFEQIFGGFKVIDF-SGNRFSGHIPRS-IGL 670 Query: 379 LQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKL 558 L L LNL+ N + KLET+DLS N +S E+ R + L+ + Sbjct: 671 LS---ELLHLNLSGNAFTGNIPPSLASITKLETLDLSRNNLSG--EIPRGLGKLSFLSNI 725 Query: 559 VLANNNIEEL-PQ 594 ++N++E L PQ Sbjct: 726 NFSHNHLEGLVPQ 738 >At3g14350.3 68416.m01816 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 689 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL 510 L+ LNL NNQ A + L+ ++L+HN++ L Sbjct: 119 LERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLKQL 156 >At3g14350.2 68416.m01814 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 680 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL 510 L+ LNL NNQ A + L+ ++L+HN++ L Sbjct: 82 LERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLKQL 119 >At3g14350.1 68416.m01815 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 717 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL 510 L+ LNL NNQ A + L+ ++L+HN++ L Sbjct: 119 LERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLKQL 156 >At3g11010.1 68416.m01329 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 894 Score = 27.9 bits (59), Expect = 6.4 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 K G++PK+ + LL+ L LNL+NN S L LE++D+S N++ Sbjct: 714 KFEGEIPKS-IGLLK---ELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKL 763 >At1g71390.1 68414.m08243 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5B [Lycopersicon esculentum] gi|3894391|gb|AAC78595 Length = 784 Score = 27.9 bits (59), Expect = 6.4 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +I G++P++ + L+ L+ LNL+ N + L KLET+DLS N++S Sbjct: 609 RIYGEIPES-IGCLE---ELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLS 659 >At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, putative (TMK1) identical to protein kinase TMK1 gi|166888|gb|AAA32876, SP|P43298 Putative receptor protein kinase TMK1 precursor (EC 2.7.1.-) {Arabidopsis thaliana} Length = 942 Score = 27.9 bits (59), Expect = 6.4 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +1 Query: 388 TYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISD-LEELFRFETRPYKLNKLVL 564 T R+ + + ++ ++ L +LE ++L N IS + L + L L+L Sbjct: 63 TKRVTRIQIGHSGLQGTLSPDLRNLSELERLELQWNNISGPVPSLSGLAS----LQVLML 118 Query: 565 ANNNIEELPQDAF 603 +NNN + +P D F Sbjct: 119 SNNNFDSIPSDVF 131 >At1g33610.1 68414.m04160 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 907 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +L+ L+L+ N+ + F L + +DLSHN ++ Sbjct: 273 KLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLT 309 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 346 TGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHN 495 TG +P + L + T+ LNL NN++ + F + +L ++DLS N Sbjct: 616 TGHIPSSIANLTRLTW----LNLGNNRLSGTIPNIFKSMKELNSLDLSRN 661 >At1g13230.1 68414.m01535 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to gb|U42445 Cf-2.2 from Lycopersicon pimpinellifolium Length = 424 Score = 27.9 bits (59), Expect = 6.4 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L L+L+NN +E +L L +DL +NR S L + L +LVL+NN Sbjct: 241 LLKLDLSNNLLEGNLPQELGFLKNLTLLDLRNNRFSG--GLSKNIENIQSLTELVLSNNP 298 Query: 577 IEE 585 + E Sbjct: 299 MGE 301 >At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 892 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANN 573 R+ LNL+++ + I + L LE +DLS+N ++ + F + + L + L+ N Sbjct: 420 RVLSLNLSSSGLTGIIAAAIQNLTHLEKLDLSNNTLTGVVPEFLAQMK--SLVIINLSGN 477 Query: 574 NIE-ELPQ 594 N+ LPQ Sbjct: 478 NLSGPLPQ 485 >At5g58150.1 68418.m07278 leucine-rich repeat transmembrane protein kinase, putative Length = 785 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+ LNL++N+I S L T+DLS N IS Sbjct: 115 LESLNLSSNRISEPLPSNIGNFMSLHTLDLSFNSIS 150 >At5g53890.1 68418.m06703 leucine-rich repeat transmembrane protein kinase, putative Length = 1036 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 L+ L+L+ NQ++ + L +L+ +DLSHN +S Sbjct: 90 LRVLDLSRNQLKGEVPAEISKLEQLQVLDLSHNLLS 125 >At5g27060.1 68418.m03229 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 957 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNR 498 RL LNL +NQ A S L L +DLS+NR Sbjct: 170 RLTYLNLFDNQFSGQAPSSICNLSHLTFLDLSYNR 204 >At5g25910.1 68418.m03077 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; Length = 811 Score = 27.5 bits (58), Expect = 8.5 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 K G++P++ + LL+ L LNL+NN S L +LE++D+S N++S Sbjct: 637 KFEGEIPRS-VGLLK---ELHVLNLSNNGFTGHIPSSMGNLIELESLDVSQNKLS 687 >At5g06940.1 68418.m00784 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 872 Score = 27.5 bits (58), Expect = 8.5 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 331 TSLKITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDL 510 +S + G +P+ +L LL + LQ LNL +N + I L +L +DLS N + Sbjct: 155 SSNHVEGMIPE-DLGLL---FNLQVLNLGSNLLTGIVPPAIGKLSELVVLDLSENSYL-V 209 Query: 511 EELFRFETRPYKLNKLVLANNNIE-ELP 591 E+ F + KL +L+L + E+P Sbjct: 210 SEIPSFLGKLDKLEQLLLHRSGFHGEIP 237 >At2g32680.1 68415.m03995 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 890 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +1 Query: 397 LQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRISDLEELFRFETRPYKLNKLVLANNN 576 L+ + L NN +E L T+D+SHNR++ +L R L L + NN Sbjct: 530 LELVYLRNNNLEGSIPDALCDGASLRTLDVSHNRLTG--KLPRSFVNCSSLKFLSVINNR 587 Query: 577 IEE 585 IE+ Sbjct: 588 IED 590 >At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 786 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +1 Query: 343 ITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 +TG +P L Q +Q+L+L+NN + + S + L +DLS N + Sbjct: 320 LTGSLPSVFQNLTQ----IQELDLSNNSLTGLVPSFLANIKSLSLLDLSGNNFT 369 >At2g25790.1 68415.m03095 leucine-rich repeat transmembrane protein kinase, putative Length = 960 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 340 KITGQMPKTNLTLLQYTYRLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRIS 504 KI+G +P+ +T + + DL+L+ N+I + L +DLSHN + Sbjct: 489 KISGVVPQGLMTFPE----IMDLDLSENEITGVIPRELSSCKNLVNLDLSHNNFT 539 >At1g54480.1 68414.m06214 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum] Length = 550 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 394 RLQDLNLTNNQIERIAGSPFYYLGKLETIDLSHNRI 501 +L+ +NL+ N + S F L +E++DLSHN + Sbjct: 386 KLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNML 421 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,131,577 Number of Sequences: 28952 Number of extensions: 259561 Number of successful extensions: 1027 Number of sequences better than 10.0: 100 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -