BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h18 (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 31 0.026 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 5.1 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 31.5 bits (68), Expect = 0.026 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +2 Query: 374 QLILNYIYTDNVDITSIEQAFDLLYASRKYLLEHLTKTCIEYIKENVTIDNVIEVL 541 Q ++ IY D++ IE A D+L +LE KT E+ +++ D +++VL Sbjct: 35 QFLVRQIYEDDITYNLIEAAVDILNIPAGDILELFGKTFFEFCQDS-GYDKILQVL 89 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 5.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 473 HLTKTCIEYIKENVTIDNVIEVLNYPDYMHDKQLTTYAV 589 H ++T IEY+K + E Y + K +T YA+ Sbjct: 47 HYSETDIEYLKHALPQGIEDEFFEYLSQLTAKDVTLYAI 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,204 Number of Sequences: 2352 Number of extensions: 13158 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -