BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h11 (257 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR457150-1|CAG33431.1| 245|Homo sapiens RNF138 protein. 27 8.2 BT006878-1|AAP35524.1| 245|Homo sapiens STRIN protein protein. 27 8.2 BC018107-1|AAH18107.1| 245|Homo sapiens ring finger protein 138... 27 8.2 AL133557-1|CAB63712.1| 183|Homo sapiens hypothetical protein pr... 27 8.2 >CR457150-1|CAG33431.1| 245|Homo sapiens RNF138 protein. Length = 245 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 156 YKIMLHYKPCKKYRKGMSL*PFFPSKHLSVNEV 58 Y++ HYK CKKY+ + P+ +S + V Sbjct: 96 YRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSV 128 >BT006878-1|AAP35524.1| 245|Homo sapiens STRIN protein protein. Length = 245 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 156 YKIMLHYKPCKKYRKGMSL*PFFPSKHLSVNEV 58 Y++ HYK CKKY+ + P+ +S + V Sbjct: 96 YRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSV 128 >BC018107-1|AAH18107.1| 245|Homo sapiens ring finger protein 138 protein. Length = 245 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 156 YKIMLHYKPCKKYRKGMSL*PFFPSKHLSVNEV 58 Y++ HYK CKKY+ + P+ +S + V Sbjct: 96 YRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSV 128 >AL133557-1|CAB63712.1| 183|Homo sapiens hypothetical protein protein. Length = 183 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 156 YKIMLHYKPCKKYRKGMSL*PFFPSKHLSVNEV 58 Y++ HYK CKKY+ + P+ +S + V Sbjct: 34 YRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSV 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,668,606 Number of Sequences: 237096 Number of extensions: 520247 Number of successful extensions: 935 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 76,859,062 effective HSP length: 63 effective length of database: 61,922,014 effective search space used: 1362284308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -