BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h07 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 134 3e-33 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 26 1.1 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 5.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.5 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 10.0 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 10.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 10.0 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 134 bits (323), Expect = 3e-33 Identities = 62/111 (55%), Positives = 76/111 (68%) Frame = +1 Query: 262 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRY 441 D GS++ KDKFQ+NLDVQ F+PEEISVK D ++VEGKHEEK+D HGY+SR F RRY Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRY 62 Query: 442 ALPEGCTAESVESRLSSDGVLSVIAPRKVPPAVEGERKIPIAQTGPVRKEV 594 LP+G + S LSSDG+L++ PRK ER IPI TG K+V Sbjct: 63 MLPKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQV 113 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 574 RFGRSESCVHPPLLAAPSWVRLQTTHHLKTA 482 +FG CV+ ++ P W R T H+L A Sbjct: 113 QFGEGRECVNCGAISTPLWRRDGTGHYLCNA 143 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.4 bits (48), Expect = 5.7 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 5/83 (6%) Frame = +1 Query: 88 KMSLIPWLFDYEIERPRRLMDQHFGLGLTPEDFLSAAAGPLVSREYYRPWR--HLAAAAR 261 K+ PW E E+P H G + E ++ AA + S R W+ + Sbjct: 115 KIDEFPWTALIEYEKPNGRFGFHCGGSVINERYILTAAHCITS--IPRGWKVHRVRLGEW 172 Query: 262 DLGSSIKSDKDKF---QVNLDVQ 321 DL S+ + D + ++LD++ Sbjct: 173 DLSSTTDQEDDFYADAPIDLDIE 195 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 412 YISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAP 519 Y+S +F +P+GC + L + V +V+ P Sbjct: 661 YLSEEFFCTSGVPQGCVLSPLLFSLFINDVCNVLPP 696 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 159 RLGADSGRFSQCCSRPPCEQRILPPVASPCCRGSR 263 R+ +FSQ + CEQ+ LP V S C G++ Sbjct: 347 RMAKSKRKFSQ---QNCCEQQHLPHVHSEKCAGTQ 378 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -3 Query: 563 IGILRSPST-AGGTFLGAITDNTPS 492 IG+ R S+ +GG +G +TD+ S Sbjct: 1004 IGLFRRESSGSGGVVIGGVTDSETS 1028 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 542 STAGGTFLGAITDNTPSEDSR 480 S+ GG +G TD PSE R Sbjct: 1016 SSGGGPPVGTPTDGAPSEGRR 1036 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,790 Number of Sequences: 2352 Number of extensions: 14987 Number of successful extensions: 23 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -