BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h05 (591 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 7.4 U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 23 9.8 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 23 9.8 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.0 bits (47), Expect = 7.4 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -2 Query: 293 LSFVQFCDPGLILFICEVSRVSFLFAVVQTPTPASGRLLHLDRSYLPEHKEAQYE 129 L+ FC GL+ +IC+ + +A T +LL ++ S++ + +AQ E Sbjct: 265 LAVTAFCSVGLLFYICDEAH----YASFNVRTNFQKKLLMVELSWM--NTDAQTE 313 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 22.6 bits (46), Expect = 9.8 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 277 SATLVLYCSSVRSLV-SRFCLPLSKRRRPLPGDSSILTE 164 +A +V+ S R S + LPL K+R G+ +L++ Sbjct: 28 NAIIVIDASPFRQWYESHYLLPLGKKRELKAGEEDVLSK 66 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 22.6 bits (46), Expect = 9.8 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +3 Query: 363 LGTALLPPRLATEIVETAIDMGYRAIDTAYIYGNEKLIGKAIKNKI 500 L +PP L + AI G R +++ G+E ++ K NK+ Sbjct: 149 LSVVRIPPNLRQLV---AIGNGIRTVESTATNGSELILLKLAHNKL 191 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,391 Number of Sequences: 2352 Number of extensions: 10830 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -