BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h03 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 27 0.63 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 26 1.5 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 27.1 bits (57), Expect = 0.63 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 122 SSSSARNLFAESKQRLAERVQVNMNNISSLARQI-QRGSKSNELLTKAAREMASTEHQI 295 ++ +A++ +AE +LAE ++ N + AR + + N L K + E QI Sbjct: 1439 NAQTAQDKYAEEASKLAENIKKRANATKNTARDLHHEADQLNGRLAKTDNRLEEREAQI 1497 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +1 Query: 385 ADRNK*TNYSYAKMRNYWETVFVCDYTDERQKVQSTQSFLYSGG 516 A + K NY Y + +N + + F +Y+D ++ ++ GG Sbjct: 706 ATKLKPNNYEYERNQNIYNSQFKVEYSDNFNSGYGLRNAVFYGG 749 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,532 Number of Sequences: 2352 Number of extensions: 12517 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -