BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11h03 (759 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41620.1 68418.m05057 expressed protein weak similarity to mi... 32 0.48 At5g07660.1 68418.m00877 structural maintenance of chromosomes (... 30 1.5 At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zi... 30 1.5 At1g50500.1 68414.m05664 membrane trafficking VPS53 family prote... 30 1.9 At3g45000.1 68416.m04848 SNF7 family protein contains Pfam profi... 29 3.4 At3g09970.1 68416.m01196 calcineurin-like phosphoesterase family... 29 3.4 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 29 4.4 At5g07970.1 68418.m00926 dentin sialophosphoprotein-related cont... 28 5.9 At2g32240.1 68415.m03940 expressed protein contains Pfam profile... 28 5.9 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 28 5.9 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 28 5.9 At5g46050.1 68418.m05663 proton-dependent oligopeptide transport... 28 7.7 At3g09960.1 68416.m01194 calcineurin-like phosphoesterase family... 28 7.7 At2g19660.1 68415.m02297 DC1 domain-containing protein contains ... 28 7.7 >At5g41620.1 68418.m05057 expressed protein weak similarity to microtubule binding protein D-CLIP-190 (GI:2773363) [Drosophila melanogaster]; weak similarity to Synaptonemal complex protein 1 (SCP-1 protein) (Swiss-Prot:Q15431) [Homo sapiens]; weak similarity to DNA double-strand break repair rad50 ATPase. (Swiss-Prot:P58301) [Pyrococcus furiosus] Length = 543 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = +2 Query: 161 QRLAERVQVNMNNISSLARQIQRGSKSNELLTKAAREMASTEHQIETSEENLKKMQL 331 +++A + +++S+ ++++RGSKSN+++ E A E LKK L Sbjct: 216 RKMARELSEVKSSLSNCVKELERGSKSNKMMELLCDEFAKGIKSYEEEIHGLKKKNL 272 >At5g07660.1 68418.m00877 structural maintenance of chromosomes (SMC) family protein similar to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1058 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +2 Query: 233 SKSNEL---LTKAAREMASTEHQIETSEENLKKMQLIAVHIGYQFENIHKSAK 382 S NEL + K +E+ E +E +++LK+ +L A + +EN+++SAK Sbjct: 714 SSVNELHLEIMKFQKEIEEKESLLEKLQDSLKEAELKANELKASYENLYESAK 766 >At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 634 Score = 30.3 bits (65), Expect = 1.5 Identities = 28/123 (22%), Positives = 58/123 (47%), Gaps = 10/123 (8%) Frame = +2 Query: 107 KMTSASSSSARNLFAESKQRLAERVQVNMNNISSLARQIQRGSKSNEL------LTKAAR 268 KM S +F E K+RL ++ MNN+ ++Q+ + EL K Sbjct: 304 KMQELSREKINRIFRE-KERLTNELEAKMNNLKIWSKQLDKKQALTELERQKLDEDKKKS 362 Query: 269 EMASTEHQIETSEENL---KKMQLIAVHIGYQFENIHKSAKMLTEI-NEQITAMQR*EII 436 ++ ++ Q+ + E+ + ++L+ H + E ++K ++ E+ ++Q M+ E+ Sbjct: 363 DVMNSSLQLASLEQKKTDDRVLRLVDEHKRKKEETLNKILQLEKELDSKQKLQMEIQELK 422 Query: 437 GKL 445 GKL Sbjct: 423 GKL 425 >At1g50500.1 68414.m05664 membrane trafficking VPS53 family protein contains Pfam domain PF04100: Vps53-like, N-terminal Length = 798 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/111 (21%), Positives = 52/111 (46%) Frame = +2 Query: 92 YGNRIKMTSASSSSARNLFAESKQRLAERVQVNMNNISSLARQIQRGSKSNELLTKAARE 271 Y N++ T AS + L + + + +V+ + +S++ +Q G+K+ E L A R Sbjct: 9 YINQMFPTEASLTGVEPLMQKIQGEIR---RVDASILSAVRQQSNSGTKAKEDLADATRA 65 Query: 272 MASTEHQIETSEENLKKMQLIAVHIGYQFENIHKSAKMLTEINEQITAMQR 424 + H+I+ + ++ + + I + + + K +T ITA+ R Sbjct: 66 VEELSHKIQEIKSKAEQSEAMVQEICRDIKKLDFAKKNIT---TTITALHR 113 >At3g45000.1 68416.m04848 SNF7 family protein contains Pfam profile PF03357: SNF7 family Length = 200 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 8/75 (10%) Frame = +2 Query: 215 RQIQRGSKSNELLT-KA-AREMASTEHQIETSEENLKKMQLIAVHIGYQFE------NIH 370 + I+ K N+L+T KA ARE+ S+ ++ EN ++ I++H+G N+ Sbjct: 19 KAIKDSVKRNDLVTAKALAREIVSSRRTVKRLYENKAQVNSISMHLGESIATAVTVGNLS 78 Query: 371 KSAKMLTEINEQITA 415 KS +++ +N + A Sbjct: 79 KSGEVMKLVNSLMKA 93 >At3g09970.1 68416.m01196 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 Calcineurin-like phosphoesterase Length = 309 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 293 IETSEENLKKMQLIAVHIGYQ-FENIHKSAKMLTEINEQITAMQ 421 IET EE LK +LIAVH G + N+ + K+L + I+ +Q Sbjct: 198 IET-EEGLKHCKLIAVHAGLEKGNNVEEQLKLLRAKDTSISKIQ 240 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/77 (22%), Positives = 31/77 (40%) Frame = +2 Query: 101 RIKMTSASSSSARNLFAESKQRLAERVQVNMNNISSLARQIQRGSKSNELLTKAAREMAS 280 ++K + +N + +Q RVQ S L ++ + E KA +AS Sbjct: 412 KLKSELETVKEEKNRALKKEQDATSRVQRLSEEKSKLLSDLESSKEEEEKSKKAMESLAS 471 Query: 281 TEHQIETSEENLKKMQL 331 H++ + LK+ L Sbjct: 472 ALHEVSSEGRELKEKLL 488 >At5g07970.1 68418.m00926 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 1097 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = +2 Query: 194 NNISSLARQIQRGSKSNELLTKAAREMASTEHQIETSEENLKK 322 NN++ L+ + + S++ ++KAA + S ++ET L+K Sbjct: 989 NNLNPLSERTETEKMSDQYISKAAEDFISRTKKLETDFAGLEK 1031 >At2g32240.1 68415.m03940 expressed protein contains Pfam profile: PF04508 viral A-type inclusion protein repeat Length = 775 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/84 (20%), Positives = 37/84 (44%), Gaps = 2/84 (2%) Frame = +2 Query: 161 QRLAERVQVNMNNISSLARQIQR-GSKSNELLTKAAREMASTEHQ-IETSEENLKKMQLI 334 + + + V + S+ ++ G + +E++ K S E + E E K+M+L Sbjct: 177 ESIRNELNVTQGKLESIENDLKAAGLQESEVMEKLKSAEESLEQKGREIDEATTKRMELE 236 Query: 335 AVHIGYQFENIHKSAKMLTEINEQ 406 A+H ++ H+ K + E + Sbjct: 237 ALHQSLSIDSEHRLQKAMEEFTSR 260 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = -1 Query: 285 SVDAISLAAFVNSSLDLEPL*ICLANDEILFIFTCTLSASLCLDSANKF-LALLDDAEVI 109 SV+A + + + L+PL CL D ++ +FT L L +NK+ L L + Sbjct: 191 SVEAPPEDSLPQADISLQPLVQCLDVDNLIKLFTSVLVERRILIRSNKYSLLTLVSESIC 250 Query: 108 LILFP 94 +++P Sbjct: 251 HLIYP 255 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = -1 Query: 285 SVDAISLAAFVNSSLDLEPL*ICLANDEILFIFTCTLSASLCLDSANKF-LALLDDAEVI 109 SV+A + + + L+PL CL D ++ +FT L L +NK+ L L + Sbjct: 191 SVEAPPEDSLPQADISLQPLVQCLDVDNLIKLFTSVLVERRILIRSNKYSLLTLVSESIC 250 Query: 108 LILFP 94 +++P Sbjct: 251 HLIYP 255 >At5g46050.1 68418.m05663 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 582 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +3 Query: 594 LFAVGF*ILFSATELFFLMDNILCNLGFEIEYLFMTVLYKYFII 725 +F++ F LF+ T L ++ DN+ LG+ + L + + F++ Sbjct: 194 MFSIFFGTLFANTVLVYVQDNVGWTLGYGLPTLGLAISITIFLL 237 >At3g09960.1 68416.m01194 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 311 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 293 IETSEENLKKMQLIAVHIGYQFE-NIHKSAKMLTEINEQITAMQ 421 IET EE L +LIAVH G + + N+ + K+L + + I +Q Sbjct: 200 IET-EEGLTHCKLIAVHAGLETKNNVEEQLKLLRDKDTSIPRIQ 242 >At2g19660.1 68415.m02297 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 662 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 427 SSLHSCNLFIYFCQHFCRLMNVFKLISNVD 338 S+ C F Y C C+L ++ K++S D Sbjct: 608 SNTSMCRPFCYVCNSQCKLPSIVKVVSKAD 637 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,985,745 Number of Sequences: 28952 Number of extensions: 260955 Number of successful extensions: 645 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -