BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g20 (601 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 2.0 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 23 2.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 23 2.0 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 3.4 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 7.9 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 453 PPDKRRWAMRYTWNPQNNPVLNTNLKL 533 PP + + PQ+NP++NT L Sbjct: 57 PPSPQEVYYHHQTIPQDNPIINTETGL 83 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 453 PPDKRRWAMRYTWNPQNNPVLNTNLKL 533 PP + + PQ+NP++NT L Sbjct: 57 PPSPQEVYYHHQTIPQDNPIINTETGL 83 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 453 PPDKRRWAMRYTWNPQNNPVLNTNLKL 533 PP + + PQ+NP++NT L Sbjct: 57 PPSPQEVYYHHQTIPQDNPIINTETGL 83 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 22 FCLNXILNYEIKWKKTLRWILANKKSL 102 FC N +++ + T+ W L NK+++ Sbjct: 208 FCDNLQYSFDNQCSGTIDWALPNKRTV 234 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -3 Query: 491 PCVSHGPSSFIRWYVSSFYQSFPHEIIIHGL 399 P S PS WY +YQ + + H L Sbjct: 25 PAYSPPPSYCDPWYNPYYYQYLQNAALYHKL 55 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,033 Number of Sequences: 336 Number of extensions: 2325 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -