BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g18 (578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3384| Best HMM Match : K_tetra (HMM E-Value=0.003) 97 1e-20 SB_25131| Best HMM Match : Ion_trans (HMM E-Value=1.9e-37) 36 0.018 SB_27575| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_13958| Best HMM Match : K_tetra (HMM E-Value=7.00649e-45) 32 0.39 SB_11601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_28789| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_37423| Best HMM Match : K_tetra (HMM E-Value=3.2e-31) 30 1.6 SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09) 30 1.6 SB_57147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_44639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_13351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_10909| Best HMM Match : TFIIB (HMM E-Value=0.14) 29 2.7 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 29 2.7 SB_27384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_25947| Best HMM Match : TFIIB (HMM E-Value=0.0018) 29 3.6 SB_48494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_11439| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_8486| Best HMM Match : Granulin (HMM E-Value=0) 28 4.8 SB_52323| Best HMM Match : DUF1388 (HMM E-Value=5.8) 28 6.3 SB_51046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_36529| Best HMM Match : K_tetra (HMM E-Value=2e-24) 28 6.3 SB_6747| Best HMM Match : K_tetra (HMM E-Value=1e-38) 28 6.3 SB_46471| Best HMM Match : K_tetra (HMM E-Value=1e-38) 28 6.3 SB_43693| Best HMM Match : ACBP (HMM E-Value=2.7) 28 6.3 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35869| Best HMM Match : Piwi (HMM E-Value=4.6e-12) 27 8.4 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_51730| Best HMM Match : Methyltransf_6 (HMM E-Value=8.8) 27 8.4 SB_45630| Best HMM Match : GIY-YIG (HMM E-Value=0.47) 27 8.4 SB_35438| Best HMM Match : GXGXG (HMM E-Value=1.9) 27 8.4 SB_27191| Best HMM Match : Lysis_S (HMM E-Value=5.6) 27 8.4 SB_18131| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 27 8.4 SB_14335| Best HMM Match : DUF1315 (HMM E-Value=2.7) 27 8.4 SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_3384| Best HMM Match : K_tetra (HMM E-Value=0.003) Length = 395 Score = 96.7 bits (230), Expect = 1e-20 Identities = 42/65 (64%), Positives = 56/65 (86%) Frame = +1 Query: 379 DRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRAI 558 +++TLVVDNTRFVVD S FTAHPNTM+GRMF S ++T N++GE EVA+GISA+VF+ I Sbjct: 101 EKLTLVVDNTRFVVDRSLFTAHPNTMMGRMFGSNNDYTTRNDKGEVEVAQGISASVFKCI 160 Query: 559 LEYYR 573 L++Y+ Sbjct: 161 LDFYK 165 >SB_25131| Best HMM Match : Ion_trans (HMM E-Value=1.9e-37) Length = 464 Score = 36.3 bits (80), Expect = 0.018 Identities = 23/66 (34%), Positives = 31/66 (46%) Frame = +1 Query: 376 DDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRA 555 D R+TL V RF S +PNT+LG S + E+ EY + +FR Sbjct: 67 DKRVTLNVSGRRFCTWESTLKKYPNTLLG---SDALNLYFDKEKREYFLDR--DPHIFRY 121 Query: 556 ILEYYR 573 IL YY+ Sbjct: 122 ILNYYK 127 >SB_27575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 34.7 bits (76), Expect = 0.055 Identities = 24/73 (32%), Positives = 32/73 (43%) Frame = +1 Query: 355 APKHQLGDDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGI 534 A + GD R+T V RF S PNT+LG S I+ + EY + Sbjct: 52 AQRRSAGDKRVTFNVSGRRFETWESTLKRFPNTVLG---SKMIQRFYDTNTKEYFIDR-- 106 Query: 535 SATVFRAILEYYR 573 +FR +L YYR Sbjct: 107 DPYLFRFVLNYYR 119 >SB_13958| Best HMM Match : K_tetra (HMM E-Value=7.00649e-45) Length = 623 Score = 31.9 bits (69), Expect = 0.39 Identities = 23/80 (28%), Positives = 34/80 (42%) Frame = +1 Query: 334 AQEPPKNAPKHQLGDDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGE 513 A P P+ D+R+T+ V RF + P T+LG S ++ + E E Sbjct: 23 ATSPMPPPPESSKTDERVTINVSGRRFETWRNTLARFPETLLG---SDEKDYFYDAETKE 79 Query: 514 YEVAEGISATVFRAILEYYR 573 Y +FR +L YYR Sbjct: 80 YFFDR--DPDLFRHLLNYYR 97 >SB_11601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 30.7 bits (66), Expect = 0.90 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G CS+L++ + D +DA P CC Sbjct: 113 GGCSVLEVNVSDTADAGPEHCC 134 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 4/75 (5%) Frame = +1 Query: 58 PPRR-HRSV---DRDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEE 225 PPR H S+ D+D+ A+ + SDS H ++++ RS F ++ S E N+ ++ Sbjct: 239 PPRPGHHSMGSNDQDLVAKWLRDDKASDSPDHNLSVNEARSQF--EAQENSSE-NKPEQQ 295 Query: 226 RRRRLSKRSGVSNRP 270 + S+ S RP Sbjct: 296 NKSNFSRSKSFSGRP 310 >SB_28789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 103 GDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLSKRSGVSNRPR 273 GD H+ ++S GE++ D R +P SGS E + + RR S+ + N R Sbjct: 14 GDGHSGETESITQGESLRD-RMLKHPQQGSGSHENQKSESKVTRRDSRGNEEVNLSR 69 >SB_37423| Best HMM Match : K_tetra (HMM E-Value=3.2e-31) Length = 153 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/79 (29%), Positives = 38/79 (48%) Frame = +1 Query: 337 QEPPKNAPKHQLGDDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEY 516 QE K K + ++ T+ V RF+VD F+ P+T+LG F P+++ EY Sbjct: 33 QEREKAKEKARNRNNFTTINVSGRRFLVDIEIFSRFPDTLLGSTMKQ--HFYDPSKK-EY 89 Query: 517 EVAEGISATVFRAILEYYR 573 VF+ I+ +Y+ Sbjct: 90 FFDR--DPEVFKYIITFYK 106 >SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09) Length = 1472 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Frame = -2 Query: 169 TTCDHSLPHHVPESQTY-------ARARLRELLHHGPHSGASEAE 56 +TCD+S PH PES T R R HH P S + E Sbjct: 391 STCDNSTPHKPPESPTELSTMPQPVSPRERGKAHHSPKSSPEDGE 435 >SB_57147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1259 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G CS+L++ + + +DA P CC Sbjct: 882 GGCSVLEVNVSNTADAEPEHCC 903 >SB_44639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G CS+L++ + + +DA P CC Sbjct: 71 GGCSVLEVNVSNTADAEPEHCC 92 >SB_13351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +1 Query: 385 ITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRAILE 564 I L V F T P++MLG MFS I + + G + + T+FR IL Sbjct: 277 IDLNVGGNHFTTTLLTLTTFPDSMLGSMFSGRIP-VNRDSNGRFFIDR--DGTLFRYILN 333 Query: 565 YYR 573 + R Sbjct: 334 FLR 336 >SB_10909| Best HMM Match : TFIIB (HMM E-Value=0.14) Length = 666 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G CS+L++ + + +DA P CC Sbjct: 128 GGCSVLEVNVSNTADAEPEHCC 149 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/63 (31%), Positives = 29/63 (46%) Frame = +1 Query: 67 RHRSVDRDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLSK 246 + RS RD AR E S + DRRS + + +S + +R+ + R SK Sbjct: 340 KRRSSSRDESAR--ERPDSSYRRRSKSKSPDRRSRKFEEQTSHRQSMSRERDRRPVEASK 397 Query: 247 RSG 255 RSG Sbjct: 398 RSG 400 >SB_27384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G CS+L++ + + +DA P CC Sbjct: 320 GGCSVLEVNVSNTADAEPEHCC 341 >SB_25947| Best HMM Match : TFIIB (HMM E-Value=0.0018) Length = 581 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G C +L++ + D +DA P CC Sbjct: 55 GGCPVLEVNVSDTADAGPEHCC 76 >SB_48494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 271 GACSILQIALRDVSDAPPRLCC 206 G C +L++ + D +DA P CC Sbjct: 65 GGCPVLEVNVSDTADAGPEHCC 86 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 361 KHQLGDDRITLVVDNTRFVVDPSQF 435 K QL DR LV D T+FV+D ++F Sbjct: 800 KTQLVIDRTQLVTDGTQFVIDKTRF 824 >SB_11439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.3 bits (60), Expect = 4.8 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +2 Query: 203 STTETRRSVGDVSQSDLEYRTGPALLQCSPGRVRLVTRCHRPLQLRNLRKTLRSTNSE 376 S ++ S G+ SQ D PAL P R ++T R R RK L + NSE Sbjct: 242 SASQKELSDGEGSQGD------PALASFRPRRQHIITMATRKSSARERRKMLGTRNSE 293 >SB_8486| Best HMM Match : Granulin (HMM E-Value=0) Length = 878 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = -2 Query: 265 CSILQIALRDVSDAPPRLCCTLPSHCCYQDRKTTCDHSLPHHVPESQTYARARLRELLH 89 C + + L P +CC HCC K CD + H + ++++ L+H Sbjct: 128 CCLTEFGLYGCCPTPKAVCCLDRLHCCPSGYK--CDLA-RHECVQENVQTNSQVKPLIH 183 >SB_52323| Best HMM Match : DUF1388 (HMM E-Value=5.8) Length = 302 Score = 27.9 bits (59), Expect = 6.3 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +1 Query: 88 DVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYN--RDAEERRRRL-SKRSGV 258 DVK D D++AH RRS P+ +G E + RD EER+ + S+R V Sbjct: 226 DVKRSPDVRRTPDDARAHKSPDVPRRSPDVPNRYNGVHEKSPWRDGEERKIVIKSEREDV 285 Query: 259 S 261 S Sbjct: 286 S 286 >SB_51046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 27.9 bits (59), Expect = 6.3 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 6/76 (7%) Frame = +1 Query: 88 DVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEE------RRRRLSKR 249 D + D + SDS + S S SSS SEE + + E+ R++ + Sbjct: 108 DAEGSSDSDSDSSDSSGSDDDSSSSSSSSSSSSSSSSEETDNETEQPATPAPSRQKPTSL 167 Query: 250 SGVSNRPRAPTMQSGA 297 +G S P Q+GA Sbjct: 168 NGASLGYDTPAFQAGA 183 >SB_36529| Best HMM Match : K_tetra (HMM E-Value=2e-24) Length = 279 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +1 Query: 376 DDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRA 555 +DRI + + R+ S +PNT+LG S I+ + ++ + E + F A Sbjct: 18 NDRIVINISGERYETLESTLMRYPNTLLG----SPIKRSQYFDQRQCEYFXNRNRQAFDA 73 Query: 556 ILEYYR 573 IL YY+ Sbjct: 74 ILFYYQ 79 >SB_6747| Best HMM Match : K_tetra (HMM E-Value=1e-38) Length = 404 Score = 27.9 bits (59), Expect = 6.3 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +1 Query: 376 DDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRA 555 D RIT+ V +FV HP+T+LG ++F +R E +FR Sbjct: 24 DRRITINVSGKKFVTWEKTLRKHPSTLLGS--DRLMQFFDETKR---EFFLDRDPHMFRY 78 Query: 556 ILEYYR 573 IL +YR Sbjct: 79 ILNFYR 84 >SB_46471| Best HMM Match : K_tetra (HMM E-Value=1e-38) Length = 347 Score = 27.9 bits (59), Expect = 6.3 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +1 Query: 376 DDRITLVVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRA 555 D RIT+ V +FV HP+T+LG ++F +R E +FR Sbjct: 24 DRRITINVSGKKFVTWEKTLRKHPSTLLGS--DRLMQFFDETKR---EFFLDRDPHMFRY 78 Query: 556 ILEYYR 573 IL +YR Sbjct: 79 ILNFYR 84 >SB_43693| Best HMM Match : ACBP (HMM E-Value=2.7) Length = 354 Score = 27.9 bits (59), Expect = 6.3 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +1 Query: 88 DVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYN--RDAEERRRRL-SKRSGV 258 DVK D D++AH RRS P+ +G E + RD EER+ + S+R V Sbjct: 200 DVKRSPDVRRTPDDARAHKSPDVPRRSPDVPNRYNGVHEKSPWRDGEERKIVIKSEREDV 259 Query: 259 S 261 S Sbjct: 260 S 260 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +1 Query: 85 RDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLSKRS 252 R ++ ++H R S S + R S+ DS EY+RD+ LS+ S Sbjct: 1416 RSSRSSYEDHPRSSRSSYEDRSRDSRGSYGARDSYGSYPEYSRDSRGGYANLSRDS 1471 >SB_35869| Best HMM Match : Piwi (HMM E-Value=4.6e-12) Length = 243 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 361 KHQLGDDRITLVVDNTRFVVDPSQFTAHPNTMLGR 465 +H D R L+ RF+ +FTAH + ++ R Sbjct: 170 RHATHDKRHRLITREDRFITREDRFTAHEDRIIAR 204 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/58 (24%), Positives = 24/58 (41%) Frame = +1 Query: 64 RRHRSVDRDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRR 237 ++ +R K + +E R + + H E + Y DS G + EER+ R Sbjct: 482 KQREEEERKQKEKEEEKKRKEEERKHKEEEEKKTEESYDDSWRGRRARRKAEEERKER 539 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 67 RHRSVDRDVKARGDEHARMSDSQAHG-EAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLS 243 +HRS DR + GD H R Q G +A +D R + S ++ ++E++ + + Sbjct: 267 KHRSKDRTRRDSGDSHERQHRPQRSGSDASNDSRRGTH---RSRKHKHRLESEKKAKNVK 323 Query: 244 K 246 K Sbjct: 324 K 324 >SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 27.5 bits (58), Expect = 8.4 Identities = 19/67 (28%), Positives = 29/67 (43%) Frame = +1 Query: 64 RRHRSVDRDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLS 243 R RS +R +E R + + +A + +S SGS + + E RRR L Sbjct: 116 RDRRSKERSKDESKEERRRSKERENSPDAKKGKDK---ENSDSGSSDSETELENRRRALL 172 Query: 244 KRSGVSN 264 K V+N Sbjct: 173 KELEVAN 179 >SB_51730| Best HMM Match : Methyltransf_6 (HMM E-Value=8.8) Length = 409 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -1 Query: 536 EIPSATSYSPLSFGCVNSIPELNILPSIVLGCAVN*EGSTTNLVLSTTNVIRSSP 372 ++ S T Y NSI L+I ++ V S T V+ T N+ RS P Sbjct: 55 KVISKTEYGSKLPNITNSIDTLHINTDLITDSIVGGRASNTLFVIQTHNLSRSYP 109 >SB_45630| Best HMM Match : GIY-YIG (HMM E-Value=0.47) Length = 200 Score = 27.5 bits (58), Expect = 8.4 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = +1 Query: 85 RDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLSKRSG--V 258 R +K R ++H R DSQ+ F P+ SS E + R R S R G Sbjct: 120 RKLKERFNDHRRTVDSQSRSIPTHAAEHFLKPNHSSSDIELIPIEKIRNNRDSIRKGREA 179 Query: 259 SNRPRAPTMQSG 294 + RA T++ G Sbjct: 180 TLIARANTLEPG 191 >SB_35438| Best HMM Match : GXGXG (HMM E-Value=1.9) Length = 602 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -1 Query: 536 EIPSATSYSPLSFGCVNSIPELNILPSIVLGCAVN*EGSTTNLVLSTTNVIRSSP 372 ++ S T Y NSI L+I ++ V S T V+ T N+ RS P Sbjct: 55 KVISKTEYGSKLPNITNSIDTLHINTDLITDSIVGGRASNTLFVIQTHNLSRSYP 109 >SB_27191| Best HMM Match : Lysis_S (HMM E-Value=5.6) Length = 181 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -1 Query: 536 EIPSATSYSPLSFGCVNSIPELNILPSIVLGCAVN*EGSTTNLVLSTTNVIRSSP 372 ++ S T Y NSI L+I ++ V S T V+ T N+ RS P Sbjct: 77 KVISKTEYGSKLPNITNSIDTLHINTDLITDSIVGGRASNTLFVIPTDNLSRSYP 131 >SB_18131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +1 Query: 85 RDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDSSSGSEEYNRDAEERRRRLSKRS 252 R ++ ++H R S S + R S+ DS EY+RD+ LS+ S Sbjct: 87 RSSRSSYEDHPRSSRSSYEDRSRDSRGSYGARDSYGSYPEYSRDSRGGYANLSRDS 142 >SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) Length = 571 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = +1 Query: 394 VVDNTRFVVDPSQFTAHPNTMLGRMFSSGIEFTHPNERGEYEVAEGISATVFRAILEYY 570 V+D+T+FV+D +QF +T R+ IEF P A F YY Sbjct: 420 VIDSTQFVIDSTQFVI-DSTHFVRLDPICIEFLQPGGSTSSRAAATAVELQFALYESYY 477 >SB_14335| Best HMM Match : DUF1315 (HMM E-Value=2.7) Length = 1223 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -1 Query: 536 EIPSATSYSPLSFGCVNSIPELNILPSIVLGCAVN*EGSTTNLVLSTTNVIRSSP 372 ++ S T Y NSI L+I ++ V S T V+ T N+ RS P Sbjct: 654 KVISKTEYGSKLPNITNSIDTLHINTDLITDSIVGGRASNTLFVIQTHNLSRSYP 708 >SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +1 Query: 64 RRHRSVDRDVKARGDEHARMSDSQAHGEAMSDRRSFFYPDS-SSGSEEYNRD 216 R RSV++D + GD A+ D++ G++ D S Y D+ G+++ + D Sbjct: 460 RESRSVEKDNE--GDADAKDEDAKLEGKSPEDEISEHYQDTGEDGNDQEDSD 509 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.130 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,394,960 Number of Sequences: 59808 Number of extensions: 379876 Number of successful extensions: 1503 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1501 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -