BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g16 (577 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820,376... 29 3.5 01_01_0092 + 722744-723459,723542-723711,723792-724885 29 3.5 06_03_0683 - 23490215-23490997 28 6.1 04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506... 27 8.1 01_01_0826 + 6431621-6431917,6432356-6432505,6432614-6432796,643... 27 8.1 >06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820, 3764013-3764961,3766967-3767064,3768144-3768284, 3768758-3768874,3768924-3769013,3769014-3771818 Length = 1632 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 169 HVPMAEPFAI-QSVCSFVEADPHFCGHRAKN 258 HVPM EP I S C V AD G KN Sbjct: 1336 HVPMQEPLRIASSCCEIVNADQVCAGEVGKN 1366 >01_01_0092 + 722744-723459,723542-723711,723792-724885 Length = 659 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 146 VSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGPRIY 262 +S + +F NL S PLW +P F D+G ++Y Sbjct: 92 ISYNESRFWVVDANLDNSSCPLPLWNNLPYFNDMGTKLY 130 >06_03_0683 - 23490215-23490997 Length = 260 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = -2 Query: 153 METGCAITSLSRAGKAVTVAKPAKAMKTAKRRGENIFLDIRVSNS 19 ++TG ++L++ + +T K + + +R E I++D+R+ S Sbjct: 76 IKTGMPTSTLTKHLRGLTSKGVLKVVNSVHKRAEKIYMDVRIDPS 120 >04_04_0964 - 29749624-29749649,29749742-29749945,29750036-29750634, 29750742-29750826,29750914-29751562,29751568-29751643, 29753891-29753957,29754097-29754998,29756579-29756790 Length = 939 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 386 HDVFASQFFHTYSLPVNSSAADVTAELTSD 475 HD F + H S+P+ A V AE++ D Sbjct: 809 HDSFLRSYLHLTSMPLPCEGAAVPAEISKD 838 >01_01_0826 + 6431621-6431917,6432356-6432505,6432614-6432796, 6433305-6433385,6433548-6433586,6433646-6433849, 6433933-6434073,6434270-6434437,6434498-6434518 Length = 427 Score = 27.5 bits (58), Expect = 8.1 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 168 NWSSVMETGCAITSLSRAGKAVTVAKPAKAMKTAKRRGE-NIFLDIRVSNSS 16 N S ME I L RAG VTVA ++ RR + N+ DI V ++ Sbjct: 257 NGSEEMEALNLIDILRRAGANVTVASVEDKLQVVTRRHKFNLIADIMVEEAA 308 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,038,330 Number of Sequences: 37544 Number of extensions: 223903 Number of successful extensions: 735 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -