BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g15 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) 33 0.21 SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_29977| Best HMM Match : IL8 (HMM E-Value=1) 29 2.6 SB_10085| Best HMM Match : Sod_Fe_N (HMM E-Value=1.4) 29 3.5 SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) Length = 464 Score = 33.1 bits (72), Expect = 0.21 Identities = 24/70 (34%), Positives = 32/70 (45%) Frame = +2 Query: 29 LVCSDNVRTLKTVLTVDCPWLNFESNRTLAQHMSFKEDVVLSFYINGSYPLIRLTTVFDK 208 L C NV TL+++ T W N A SFKE +VL Y G YP + ++ Sbjct: 154 LNCGVNVTTLRSLYTKS--WSNVPEQFIKAYSASFKETIVLCRY--GLYP-CNMKLFTEQ 208 Query: 209 GNNFDLCSAF 238 NN C +F Sbjct: 209 VNNIGRCFSF 218 >SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 170 SYPLIRLTTVFDKGNNFDLCSAFTFADLAGGLPIFHINPNDQRT 301 S+ + +F NF + F DL+ LPIFHI ND+ T Sbjct: 162 SHTATLIDNMFCNRPNFSQIADILFNDLSDHLPIFHICTNDENT 205 >SB_29977| Best HMM Match : IL8 (HMM E-Value=1) Length = 521 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 291 SLGLMWKMGRPPARSANVKAEHKSKLL 211 S+G +W+ G PA ++V +H S++L Sbjct: 152 SMGFLWRSGLKPAAQSSVSVQHISQIL 178 >SB_10085| Best HMM Match : Sod_Fe_N (HMM E-Value=1.4) Length = 371 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -1 Query: 506 CTLLMRKGHMSKSICEIEYYVGEMSLS 426 C L + G ++ SIC++++Y G+++ S Sbjct: 114 CDLDLNMGDLNHSICDLDHYTGDLNYS 140 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -1 Query: 506 CTLLMRKGHMSKSICEIEYYVGEMSLS 426 C L + G ++ SIC++++Y G+++ S Sbjct: 9 CDLDLNMGDLNHSICDLDHYTGDLNHS 35 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -1 Query: 506 CTLLMRKGHMSKSICEIEYYVGEMSLS 426 C L + G ++ SIC++++Y G+++ S Sbjct: 72 CDLDLNMGDLNHSICDLDHYTGDLNHS 98 >SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 336 TFTRESTSSERGTGWRGPSSAEHSATSVVTTE 431 T + ST++ RG+ G +S +ATS + TE Sbjct: 108 TIAQTSTAAPRGSSTEGRTSTRETATSSINTE 139 >SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1922 Score = 27.9 bits (59), Expect = 8.0 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 3/100 (3%) Frame = -3 Query: 420 QPKSQSVLLMKDLASQFLFPKMCSLS*MCSR--VRSLDNHCAVRWSLGLMWKM-GRPPAR 250 +P+ VLL + +AS+ + P C+ M R RS HC +WS G + ++ P + Sbjct: 1506 RPEDSRVLL-ETMASRCV-PGTCANKEMALRNPERSSRGHCCRKWSTGRVTEVYPGPDGK 1563 Query: 249 SANVKAEHKSKLLPLSNTVVSLIKG*DPLM*KLKTTSSLN 130 NVK + + + T +++I+ D + ++ + N Sbjct: 1564 VRNVKVQTATGKYSRTVTKIAVIQAADEELLQINSNRDRN 1603 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,955,855 Number of Sequences: 59808 Number of extensions: 452536 Number of successful extensions: 1368 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1368 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -