BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g14 (120 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P00408 Cluster: Cytochrome c oxidase subunit 2; n=4696;... 63 1e-09 UniRef50_Q94RS0 Cluster: Cytochrome c oxidase subunit 2; n=78; H... 60 7e-09 UniRef50_Q9G839 Cluster: Cytochrome c oxidase subunit 2; n=214; ... 60 1e-08 UniRef50_Q30IA8 Cluster: Cytochrome c oxidase subunit 2; n=3; Di... 54 8e-07 UniRef50_Q9B4Q4 Cluster: Cytochrome c oxidase subunit 2; n=153; ... 48 4e-05 UniRef50_P00405 Cluster: Cytochrome c oxidase subunit 2; n=1386;... 48 4e-05 UniRef50_Q6RJT8 Cluster: Cytochrome c oxidase subunit 2; n=1; Ha... 46 2e-04 UniRef50_A5YPB3 Cluster: Cytochrome c oxidase subunit 2; n=2; Te... 45 3e-04 UniRef50_Q37545 Cluster: Cytochrome c oxidase subunit 2; n=58; r... 44 7e-04 UniRef50_O21346 Cluster: Cytochrome c oxidase subunit 2; n=6; Pr... 43 0.002 UniRef50_Q4ULU3 Cluster: Probable cytochrome c oxidase subunit 2... 43 0.002 UniRef50_Q9T6E1 Cluster: Cytochrome c oxidase subunit 2; n=12; A... 42 0.002 UniRef50_Q9TA26 Cluster: Cytochrome c oxidase subunit 2; n=147; ... 42 0.003 UniRef50_Q9MGB5 Cluster: Cytochrome c oxidase subunit 2; n=91; E... 42 0.004 UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2 pol... 42 0.004 UniRef50_Q8HIN6 Cluster: Cytochrome c oxidase subunit 2; n=4; As... 41 0.005 UniRef50_Q8SHP9 Cluster: Cytochrome c oxidase subunit 2; n=83; E... 41 0.005 UniRef50_Q5P9Z0 Cluster: Cytochrome c oxidase subunit 2; n=7; Ri... 40 0.014 UniRef50_Q9XMZ4 Cluster: Cytochrome c oxidase subunit 2; n=16; N... 39 0.025 UniRef50_Q2HJL3 Cluster: Cytochrome c oxidase subunit 2; n=10; P... 39 0.025 UniRef50_P05490 Cluster: Cytochrome c oxidase subunit 2; n=31; M... 38 0.033 UniRef50_Q9T7K8 Cluster: Cytochrome c oxidase subunit 2; n=2; Cr... 38 0.058 UniRef50_Q02212 Cluster: Cytochrome c oxidase subunit 2; n=779; ... 38 0.058 UniRef50_P00403 Cluster: Cytochrome c oxidase subunit 2; n=3453;... 38 0.058 UniRef50_P48889 Cluster: Cytochrome c oxidase subunit 2; n=232; ... 38 0.058 UniRef50_Q35646 Cluster: Cytochrome c oxidase subunit 2; n=1; Pe... 37 0.077 UniRef50_P20387 Cluster: Cytochrome c oxidase subunit 2 precurso... 37 0.077 UniRef50_Q6J977 Cluster: Cytochrome c oxidase subunit 2; n=4; En... 37 0.10 UniRef50_P21534 Cluster: Cytochrome c oxidase subunit 2; n=88; E... 37 0.10 UniRef50_Q06Y85 Cluster: Cytochrome c oxidase subunit 2; n=3; As... 36 0.13 UniRef50_Q9B8A2 Cluster: Cytochrome c oxidase subunit 2; n=2; Bi... 36 0.18 UniRef50_Q8HN46 Cluster: Cytochrome c oxidase subunit 2; n=5; On... 36 0.18 UniRef50_Q6Y409 Cluster: Cytochrome c oxidase subunit 2; n=2; Co... 36 0.18 UniRef50_P00410 Cluster: Cytochrome c oxidase subunit 2 precurso... 36 0.24 UniRef50_P24894 Cluster: Cytochrome c oxidase subunit 2; n=51; C... 35 0.41 UniRef50_Q09QS9 Cluster: Cytochrome c oxidase subunit 2; n=1; Ha... 34 0.54 UniRef50_Q6J979 Cluster: Cytochrome c oxidase subunit 2; n=4; Ob... 34 0.54 UniRef50_A5G0I4 Cluster: Cytochrome c oxidase, subunit II precur... 34 0.72 UniRef50_Q73I77 Cluster: Cytochrome c oxidase subunit 2; n=4; Wo... 33 0.95 UniRef50_Q9T6M4 Cluster: Cytochrome c oxidase subunit 2; n=7; Ch... 33 0.95 UniRef50_Q2TUA5 Cluster: Cytochrome c oxidase subunit 2; n=7; Eu... 32 2.2 UniRef50_Q9TAK4 Cluster: Cytochrome c oxidase subunit 2; n=5; Eu... 32 2.9 UniRef50_Q9AQY5 Cluster: Cytochrome c oxidase subunit 2; n=6; Ch... 31 3.8 UniRef50_Q94QP4 Cluster: Cytochrome c oxidase subunit 2; n=2; Un... 31 5.1 >UniRef50_P00408 Cluster: Cytochrome c oxidase subunit 2; n=4696; Metazoa|Rep: Cytochrome c oxidase subunit 2 - Drosophila melanogaster (Fruit fly) Length = 228 Score = 62.9 bits (146), Expect = 1e-09 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXNN 119 YS FNNIEFDSY+IP+NE+ + FRLLDVD R++LP N+ Sbjct: 110 YSDFNNIEFDSYMIPTNELMTDGFRLLDVDNRVVLPMNS 148 >UniRef50_Q94RS0 Cluster: Cytochrome c oxidase subunit 2; n=78; Hexapoda|Rep: Cytochrome c oxidase subunit 2 - Cheilosia urbana Length = 227 Score = 60.5 bits (140), Expect = 7e-09 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXNN 119 YS F NIEFDSY+IPSNE++ FRLLDVD RIILP N+ Sbjct: 110 YSDFINIEFDSYMIPSNELEIYNFRLLDVDNRIILPMNH 148 >UniRef50_Q9G839 Cluster: Cytochrome c oxidase subunit 2; n=214; Mandibulata|Rep: Cytochrome c oxidase subunit 2 - Hypoderma lineatum (Early cattle grub) (Common cattle grub) Length = 226 Score = 59.7 bits (138), Expect = 1e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 YS F NIEFDSY+IP+N++ N FRLLDVD R+I P N Sbjct: 110 YSDFTNIEFDSYMIPTNDLSMNNFRLLDVDNRVITPMN 147 >UniRef50_Q30IA8 Cluster: Cytochrome c oxidase subunit 2; n=3; Dichroplini|Rep: Cytochrome c oxidase subunit 2 - Atrachelacris olivaceus Length = 123 Score = 53.6 bits (123), Expect = 8e-07 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 YS F N+EFD+Y+ P N+++N+ FRLL VD R ILP N Sbjct: 41 YSDFVNVEFDTYMTPENDLENBGFRLLXVDNRTILPMN 78 >UniRef50_Q9B4Q4 Cluster: Cytochrome c oxidase subunit 2; n=153; Neoptera|Rep: Cytochrome c oxidase subunit 2 - Diadasia afflicta Length = 189 Score = 48.0 bits (109), Expect = 4e-05 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y FNNIEFDSY+I +N NN FRLLD D R+I+P Sbjct: 110 YPEFNNIEFDSYMI-NNFNNNNFFRLLDTDNRLIIP 144 >UniRef50_P00405 Cluster: Cytochrome c oxidase subunit 2; n=1386; Coelomata|Rep: Cytochrome c oxidase subunit 2 - Mus musculus (Mouse) Length = 227 Score = 48.0 bits (109), Expect = 4e-05 Identities = 18/36 (50%), Positives = 29/36 (80%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y+ + ++ FDSY+IP+N++K E RLL+VD R++LP Sbjct: 110 YTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLP 145 >UniRef50_Q6RJT8 Cluster: Cytochrome c oxidase subunit 2; n=1; Harmonia axyridis|Rep: Cytochrome c oxidase subunit 2 - Harmonia axyridis (Multicolored Asian lady beetle) Length = 193 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y+ F N+EFDSY+I +N++ N FRLL+VD R ILP Sbjct: 102 YTDFKNLEFDSYLINNNQLFN--FRLLEVDNRTILP 135 >UniRef50_A5YPB3 Cluster: Cytochrome c oxidase subunit 2; n=2; Tettigoniinae|Rep: Cytochrome c oxidase subunit 2 - Paratlanticus ussuriensis Length = 179 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +3 Query: 24 EFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 EFDSY++P +E N FRLLDVD R ILP N Sbjct: 107 EFDSYMLPYDEAPENGFRLLDVDNRTILPMN 137 >UniRef50_Q37545 Cluster: Cytochrome c oxidase subunit 2; n=58; root|Rep: Cytochrome c oxidase subunit 2 - Lumbricus terrestris (Common earthworm) Length = 228 Score = 44.0 bits (99), Expect = 7e-04 Identities = 15/36 (41%), Positives = 29/36 (80%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y+ F N+E DSY++P++++ ++RLL+VD R+++P Sbjct: 110 YTDFLNVEMDSYMLPTSDLLPGDYRLLEVDNRMVVP 145 >UniRef50_O21346 Cluster: Cytochrome c oxidase subunit 2; n=6; Protostomia|Rep: Cytochrome c oxidase subunit 2 - Euhadra herklotsi Length = 227 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/33 (45%), Positives = 27/33 (81%) Frame = +3 Query: 18 NIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 N ++DSY+ P+++++ E+RLL+VD R++LP N Sbjct: 116 NKQYDSYMTPTSDLQPGEYRLLEVDNRVVLPSN 148 >UniRef50_Q4ULU3 Cluster: Probable cytochrome c oxidase subunit 2; n=13; cellular organisms|Rep: Probable cytochrome c oxidase subunit 2 - Rickettsia felis (Rickettsia azadi) Length = 315 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 Y +N+EFDS +I +K ++ RLLDVD RI++P N Sbjct: 184 YPDHDNLEFDSVMISDENLKPDQKRLLDVDNRIVIPEN 221 >UniRef50_Q9T6E1 Cluster: Cytochrome c oxidase subunit 2; n=12; Agathis sp. DMA-1998|Rep: Cytochrome c oxidase subunit 2 - Agathis sp. DMA-1998 Length = 185 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 YS FN I FDS+++ + K + FRLLDVD R+ILP N Sbjct: 109 YSDFNEINFDSFMLKDFK-KIDLFRLLDVDNRLILPYN 145 >UniRef50_Q9TA26 Cluster: Cytochrome c oxidase subunit 2; n=147; Coelomata|Rep: Cytochrome c oxidase subunit 2 - Loxodonta africana (African elephant) Length = 228 Score = 41.9 bits (94), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y+ + ++ FDSY+I ++ +K E RLL+VD R++LP Sbjct: 110 YTDYEDLAFDSYMITTDSLKFGELRLLEVDNRMVLP 145 >UniRef50_Q9MGB5 Cluster: Cytochrome c oxidase subunit 2; n=91; Eukaryota|Rep: Cytochrome c oxidase subunit 2 - Chrysodidymus synuroideus Length = 273 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +3 Query: 18 NIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 +I FDSY++ SN++ FRLL+VD R+ILP Sbjct: 158 SINFDSYMVSSNDLIKGGFRLLEVDNRVILP 188 >UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2 polyprotein; n=1; Phaeosphaeria nodorum SN15|Rep: Cytochrome oxidase subunits 1 and 2 polyprotein - Phaeosphaeria nodorum SN15 Length = 789 Score = 41.5 bits (93), Expect = 0.004 Identities = 14/30 (46%), Positives = 24/30 (80%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 +EFDSY++P ++++ R+L+VD R+ILP Sbjct: 679 VEFDSYLVPESDLEEGALRMLEVDNRVILP 708 >UniRef50_Q8HIN6 Cluster: Cytochrome c oxidase subunit 2; n=4; Ascidiacea|Rep: Cytochrome c oxidase subunit 2 - Ciona intestinalis (Transparent sea squirt) Length = 229 Score = 41.1 bits (92), Expect = 0.005 Identities = 14/33 (42%), Positives = 25/33 (75%) Frame = +3 Query: 12 FNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 FN+ + SY++PS +++ +FRLL+VD ++LP Sbjct: 113 FNDFDMSSYMVPSEDLQEGQFRLLEVDNSMVLP 145 >UniRef50_Q8SHP9 Cluster: Cytochrome c oxidase subunit 2; n=83; Eukaryota|Rep: Cytochrome c oxidase subunit 2 - Trichoderma reesei (Hypocrea jecorina) Length = 540 Score = 41.1 bits (92), Expect = 0.005 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 IEFDSYI+P ++++ R+L+VD R+I+P Sbjct: 430 IEFDSYIVPDSDLEEGGLRMLEVDNRVIVP 459 >UniRef50_Q5P9Z0 Cluster: Cytochrome c oxidase subunit 2; n=7; Rickettsiales|Rep: Cytochrome c oxidase subunit 2 - Anaplasma marginale (strain St. Maries) Length = 276 Score = 39.5 bits (88), Expect = 0.014 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 I FDSY+ P +E+++ E RLL+VD R+++P Sbjct: 162 IRFDSYMKPDSELESGELRLLEVDNRMVVP 191 >UniRef50_Q9XMZ4 Cluster: Cytochrome c oxidase subunit 2; n=16; Neoptera|Rep: Cytochrome c oxidase subunit 2 - Stomaphis pini Length = 220 Score = 38.7 bits (86), Expect = 0.025 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 YS F NIEF+S +I N FRL++VD + ILP N Sbjct: 110 YSDFLNIEFESXMI--NNFNKENFRLIEVDNKTILPFN 145 >UniRef50_Q2HJL3 Cluster: Cytochrome c oxidase subunit 2; n=10; Protostomia|Rep: Cytochrome c oxidase subunit 2 - Campanulotes bidentatus compar (small pigeon louse) Length = 241 Score = 38.7 bits (86), Expect = 0.025 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXNN 119 Y ++ FDSY+IP+ ++ +FRLL+VD + +P N+ Sbjct: 125 YEDLSSSSFDSYMIPTCDLLKGDFRLLEVDKSVKVPLNS 163 >UniRef50_P05490 Cluster: Cytochrome c oxidase subunit 2; n=31; Magnoliophyta|Rep: Cytochrome c oxidase subunit 2 - Oenothera bertiana (Bertero's evening primrose) Length = 258 Score = 38.3 bits (85), Expect = 0.033 Identities = 13/31 (41%), Positives = 25/31 (80%) Frame = +3 Query: 18 NIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 ++ FDSY+IP ++++ + RLL+VD R+++P Sbjct: 141 SLTFDSYMIPEDDLELGQLRLLEVDNRVVVP 171 >UniRef50_Q9T7K8 Cluster: Cytochrome c oxidase subunit 2; n=2; Crassostrea|Rep: Cytochrome c oxidase subunit 2 - Crassostrea gigas (Pacific oyster) (Crassostrea angulata) Length = 233 Score = 37.5 bits (83), Expect = 0.058 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y+ F + ++SY++P +E+K E RLL VD ++LP Sbjct: 110 YTDFAVVSYNSYMVPEDELKLGEPRLLTVDKSMVLP 145 >UniRef50_Q02212 Cluster: Cytochrome c oxidase subunit 2; n=779; root|Rep: Cytochrome c oxidase subunit 2 - Phytophthora megasperma (Potato pink rot fungus) Length = 266 Score = 37.5 bits (83), Expect = 0.058 Identities = 13/31 (41%), Positives = 24/31 (77%) Frame = +3 Query: 27 FDSYIIPSNEIKNNEFRLLDVDXRIILPXNN 119 FDSY+I +++ +FR+L+VD R+++P N+ Sbjct: 143 FDSYMIQEDDLAIGQFRILEVDNRVVVPTNS 173 >UniRef50_P00403 Cluster: Cytochrome c oxidase subunit 2; n=3453; Eukaryota|Rep: Cytochrome c oxidase subunit 2 - Homo sapiens (Human) Length = 227 Score = 37.5 bits (83), Expect = 0.058 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y+ + + F+SY++P ++ + RLLDVD R++LP Sbjct: 110 YTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLP 145 >UniRef50_P48889 Cluster: Cytochrome c oxidase subunit 2; n=232; Coelomata|Rep: Cytochrome c oxidase subunit 2 - Albinaria coerulea (Land snail) Length = 224 Score = 37.5 bits (83), Expect = 0.058 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +3 Query: 15 NNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 N FDSY+IP ++K ++RLL+VD R ++P Sbjct: 114 NISNFDSYMIPEEDLKPGDYRLLEVDNRPMVP 145 >UniRef50_Q35646 Cluster: Cytochrome c oxidase subunit 2; n=1; Petunia sp.|Rep: Cytochrome c oxidase subunit 2 - Petunia sp. (Petunia) Length = 379 Score = 37.1 bits (82), Expect = 0.077 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +3 Query: 18 NIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXNN 119 ++ FDSY IP ++ + + RLL+VD R+++P N+ Sbjct: 98 SLTFDSYTIPEDDPELGQSRLLEVDNRVVVPANS 131 >UniRef50_P20387 Cluster: Cytochrome c oxidase subunit 2 precursor; n=239; Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit 2 precursor - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 247 Score = 37.1 bits (82), Expect = 0.077 Identities = 12/30 (40%), Positives = 23/30 (76%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 +EF+SY+IP + +++ + RLLD D +++P Sbjct: 137 VEFESYVIPEDLLEDGQLRLLDTDTSVVVP 166 >UniRef50_Q6J977 Cluster: Cytochrome c oxidase subunit 2; n=4; Endopterygota|Rep: Cytochrome c oxidase subunit 2 - Danaus plexippus plexippus Length = 220 Score = 36.7 bits (81), Expect = 0.10 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 33 SYIIPSNEIKNNEFRLLDVDXRIILPXNN 119 SY+I + I N FRLLDVD RIILP NN Sbjct: 120 SYMIQPSNINN--FRLLDVDNRIILPMNN 146 >UniRef50_P21534 Cluster: Cytochrome c oxidase subunit 2; n=88; Eukaryota|Rep: Cytochrome c oxidase subunit 2 - Schizosaccharomyces pombe (Fission yeast) Length = 248 Score = 36.7 bits (81), Expect = 0.10 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 + FDSY++P +++ R L+VD R++LP Sbjct: 137 VSFDSYMVPEEDLEEGSLRQLEVDNRLVLP 166 >UniRef50_Q06Y85 Cluster: Cytochrome c oxidase subunit 2; n=3; Ascomycota|Rep: Cytochrome c oxidase subunit 2 - Trigonopsis vinaria Length = 171 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +3 Query: 12 FNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 + + FDSYI + ++ E RLLDVD R+I+P Sbjct: 91 YETMGFDSYIKAEDMLETGELRLLDVDNRLIIP 123 >UniRef50_Q9B8A2 Cluster: Cytochrome c oxidase subunit 2; n=2; Bilateria|Rep: Cytochrome c oxidase subunit 2 - Trichinella spiralis (Trichina worm) Length = 225 Score = 35.9 bits (79), Expect = 0.18 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = +3 Query: 18 NIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 N+EFDSY+ E ++ +FRLLD D R++LP Sbjct: 114 NLEFDSYM---KEWESQDFRLLDCDNRVVLP 141 >UniRef50_Q8HN46 Cluster: Cytochrome c oxidase subunit 2; n=5; Onchocercidae|Rep: Cytochrome c oxidase subunit 2 - Brugia malayi (Filarial nematode worm) Length = 232 Score = 35.9 bits (79), Expect = 0.18 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 Y +++ FDS++ P +++ +FRL DVD R +LP Sbjct: 113 YGDDSSLVFDSFMKPVDDLSLGDFRLFDVDNRCVLP 148 >UniRef50_Q6Y409 Cluster: Cytochrome c oxidase subunit 2; n=2; Coelomata|Rep: Cytochrome c oxidase subunit 2 - Ophiura lutkeni Length = 237 Score = 35.9 bits (79), Expect = 0.18 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 15 NNIEFDSYIIPSNEIKNNEF-RLLDVDXRIILPXN 116 N IEFDSY+I + + RLL+VD R++LP N Sbjct: 114 NRIEFDSYMIHLEDFQQEGLPRLLEVDNRLVLPYN 148 >UniRef50_P00410 Cluster: Cytochrome c oxidase subunit 2 precursor; n=745; Eukaryota|Rep: Cytochrome c oxidase subunit 2 precursor - Saccharomyces cerevisiae (Baker's yeast) Length = 251 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 +EF+SY+IP ++ + RLLD D +++P Sbjct: 141 VEFESYVIPDELLEEGQLRLLDTDTSMVVP 170 >UniRef50_P24894 Cluster: Cytochrome c oxidase subunit 2; n=51; Chromadorea|Rep: Cytochrome c oxidase subunit 2 - Caenorhabditis elegans Length = 231 Score = 34.7 bits (76), Expect = 0.41 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 YS +EFDSY+ +++ E RLL+VD R ++P Sbjct: 113 YSDIPGLEFDSYMKSLDQLSLGEPRLLEVDNRCVIP 148 >UniRef50_Q09QS9 Cluster: Cytochrome c oxidase subunit 2; n=1; Haplomitrium mnioides|Rep: Cytochrome c oxidase subunit 2 - Haplomitrium mnioides Length = 141 Score = 34.3 bits (75), Expect = 0.54 Identities = 12/27 (44%), Positives = 22/27 (81%) Frame = +3 Query: 30 DSYIIPSNEIKNNEFRLLDVDXRIILP 110 DSY+IP ++ ++ + RLL+VD R+++P Sbjct: 37 DSYMIPEDDSESGQSRLLEVDNRVVVP 63 >UniRef50_Q6J979 Cluster: Cytochrome c oxidase subunit 2; n=4; Obtectomera|Rep: Cytochrome c oxidase subunit 2 - Danaus plexippus plexippus Length = 221 Score = 34.3 bits (75), Expect = 0.54 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 66 NEFRLLDVDXRIILPXNN 119 N FRLLDVD RIILP NN Sbjct: 130 NNFRLLDVDNRIILPMNN 147 >UniRef50_A5G0I4 Cluster: Cytochrome c oxidase, subunit II precursor; n=1; Acidiphilium cryptum JF-5|Rep: Cytochrome c oxidase, subunit II precursor - Acidiphilium cryptum (strain JF-5) Length = 316 Score = 33.9 bits (74), Expect = 0.72 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 Y ++F SY IP N+IK + L D ++LP N Sbjct: 153 YPAAKGVDFTSYPIPDNQIKPGQIARLSADHPLVLPAN 190 >UniRef50_Q73I77 Cluster: Cytochrome c oxidase subunit 2; n=4; Wolbachia|Rep: Cytochrome c oxidase subunit 2 - Wolbachia pipientis wMel Length = 254 Score = 33.5 bits (73), Expect = 0.95 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 3 YSXFNNIEFDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 Y + + FDSYI + + +L VD IILP N Sbjct: 134 YPEYQGVSFDSYIKGKEDFIEGDLKLFSVDNNIILPVN 171 >UniRef50_Q9T6M4 Cluster: Cytochrome c oxidase subunit 2; n=7; Chromadorea|Rep: Cytochrome c oxidase subunit 2 - Globodera pallida Length = 237 Score = 33.5 bits (73), Expect = 0.95 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 + FDSY++ + +FRLL+VD R++LP Sbjct: 118 LSFDSYMVFEDSFFLGDFRLLEVDNRLVLP 147 >UniRef50_Q2TUA5 Cluster: Cytochrome c oxidase subunit 2; n=7; Eukaryota|Rep: Cytochrome c oxidase subunit 2 - Dictyota dichotoma Length = 294 Score = 32.3 bits (70), Expect = 2.2 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Frame = +3 Query: 18 NIEFDSYIIPSNEI---------KNNE-FRLLDVDXRIILPXN 116 +I FDSY+IP ++ K + FRLL+VD R++LP N Sbjct: 169 SINFDSYLIPEEDLIIPKPYSTGKGGKVFRLLEVDNRVVLPVN 211 >UniRef50_Q9TAK4 Cluster: Cytochrome c oxidase subunit 2; n=5; Eukaryota|Rep: Cytochrome c oxidase subunit 2 - Cafeteria roenbergensis Length = 285 Score = 31.9 bits (69), Expect = 2.9 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +3 Query: 21 IEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 I +DSY+I +++ + E RLL+VD ++ LP Sbjct: 157 ITYDSYMISNDDAVSREQRLLEVDNKLYLP 186 >UniRef50_Q9AQY5 Cluster: Cytochrome c oxidase subunit 2; n=6; Chlamydomonadaceae|Rep: Cytochrome c oxidase subunit 2 - Polytomella sp. Pringsheim 198.80 Length = 153 Score = 31.5 bits (68), Expect = 3.8 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +3 Query: 27 FDSYIIPSNEIKNNEFRLLDVDXRIILPXN 116 FDSY++ +++ + R+L+VD R++LP N Sbjct: 44 FDSYMV--TDVQPGQLRMLEVDERLVLPTN 71 >UniRef50_Q94QP4 Cluster: Cytochrome c oxidase subunit 2; n=2; Unionidae|Rep: Cytochrome c oxidase subunit 2 - Inversidens japanensis Length = 283 Score = 31.1 bits (67), Expect = 5.1 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +3 Query: 15 NNIEFDSYIIPSNEIKNNEFRLLDVDXRIILP 110 ++ +DSY+IP + ++ +RLL+VD R ++P Sbjct: 116 SSYSYDSYLIPDSAMEEG-YRLLEVDNRCVVP 146 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,548,166 Number of Sequences: 1657284 Number of extensions: 574852 Number of successful extensions: 2317 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 2274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2311 length of database: 575,637,011 effective HSP length: 20 effective length of database: 542,491,331 effective search space used: 10307335289 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -