BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g13 (654 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35400-1|CAA84584.1| 532|Caenorhabditis elegans putative transp... 33 0.23 U12433-1|AAA20582.1| 532|Caenorhabditis elegans putative transp... 33 0.23 Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical pr... 29 2.2 Z35639-1|CAA84693.1| 1792|Caenorhabditis elegans Hypothetical pr... 29 2.2 >Z35400-1|CAA84584.1| 532|Caenorhabditis elegans putative transposase protein. Length = 532 Score = 32.7 bits (71), Expect = 0.23 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -2 Query: 254 VMCPYCQNILC*NYWV 207 ++CPYC+ +LC N+WV Sbjct: 506 LLCPYCKKVLCFNHWV 521 >U12433-1|AAA20582.1| 532|Caenorhabditis elegans putative transposase protein. Length = 532 Score = 32.7 bits (71), Expect = 0.23 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -2 Query: 254 VMCPYCQNILC*NYWV 207 ++CPYC+ +LC N+WV Sbjct: 506 LLCPYCKKVLCFNHWV 521 >Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical protein F26A3.2 protein. Length = 154 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 436 EQKMKGTLRDWRKALRTPITYRVGN 510 +Q+ +GT+RD ALRT T VGN Sbjct: 19 DQRYQGTVRDQETALRTSCTLYVGN 43 >Z35639-1|CAA84693.1| 1792|Caenorhabditis elegans Hypothetical protein D2045.2 protein. Length = 1792 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -3 Query: 601 ALMSTSNRLIKAEKFPLMSLKQLTVVVYEQHYQLCM*SVFSGLFASRAEYPSFFVLL 431 A +S N+ ++A P +S +L VY + ++CM S +A +F+VL+ Sbjct: 296 AKISAGNQFVQAAVLPFLSKSRLAPTVYMNNLKICMNGSASKSSRVQALTMNFYVLV 352 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,472,174 Number of Sequences: 27780 Number of extensions: 288418 Number of successful extensions: 654 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -