BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g09 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|c... 25 9.5 SPBC16A3.01 |spn3|SPBC543.01c|septin Spn3|Schizosaccharomyces po... 25 9.5 >SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.0 bits (52), Expect = 9.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 413 WMHSGVFFFQKTFCFCI 363 W+++ +FF + FCF I Sbjct: 345 WVYACIFFLTRVFCFLI 361 >SPBC16A3.01 |spn3|SPBC543.01c|septin Spn3|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 25.0 bits (52), Expect = 9.5 Identities = 19/68 (27%), Positives = 27/68 (39%) Frame = +3 Query: 93 SSFLYIICISFGSDIMKTTQVAQYALRLTYSQQANREKMMTRSALLLATIGLGLSTFSVR 272 S FL + F + I + L TY EK+ T LL +T+GL S Sbjct: 289 SDFLALRSALFATHIEDLHNITSNQLYETY----RTEKLSTSQLLLDSTVGLDGKNLSQH 344 Query: 273 QMILNQSR 296 +L + R Sbjct: 345 DQVLREDR 352 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,429,775 Number of Sequences: 5004 Number of extensions: 47918 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -