BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g07 (623 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0963 + 21904735-21904818,21904922-21905260 28 6.9 02_04_0454 + 23064081-23064139,23064297-23064366,23064553-230658... 28 6.9 >10_08_0963 + 21904735-21904818,21904922-21905260 Length = 140 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = -3 Query: 483 LPASFCTLISSGVGIEGLSN-MSQLATIEAAQATLEECFSRRMADLEAQLN 334 L ++ T++ GVG + ++N M Q+A A TLE F + +++ +LN Sbjct: 74 LASAAATVVVGGVGADNVTNYMGQMAIAMAMLTTLEN-FLKLRSNINGELN 123 >02_04_0454 + 23064081-23064139,23064297-23064366,23064553-23065815, 23065946-23066515 Length = 653 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 435 GLSNMSQLATIEAA-QATLEECFSRRMADLEAQLNNTAHC 319 G+S + + A A L C RR D A LN+T HC Sbjct: 112 GMSEAADRGNLAAKLDAFLASCLLRRWKDALAVLNSTRHC 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,936,596 Number of Sequences: 37544 Number of extensions: 199122 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -