BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g07 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21910.2 68417.m03167 MATE efflux family protein similar to r... 28 5.8 At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar t... 27 7.7 >At4g21910.2 68417.m03167 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 509 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 504 KLSFNN*LPASFCTLISSGVGIEGLSNMSQLATIEAAQATL-EECFS 367 KL F LPA L++SG+GI L E A A++ CFS Sbjct: 59 KLLFRLALPAILVYLVNSGMGISARIFAGHLGKNELAAASIGNSCFS 105 >At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar to Swiss-Prot:P30181 DNA topoisomerase I [Arabidopsis thaliana] Length = 917 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 401 KQHKLLSKNVSQEEWLTLKHNSTILP 324 K K L Q++W TL+HN I P Sbjct: 355 KSSKSLPSGDGQKKWKTLQHNGVIFP 380 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,160,628 Number of Sequences: 28952 Number of extensions: 176505 Number of successful extensions: 373 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -