BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g05 (315 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29153-1|AAA83086.1| 2616|Drosophila melanogaster serine proteas... 27 3.8 AE014296-1129|AAF50656.1| 2616|Drosophila melanogaster CG10129-P... 27 3.8 >U29153-1|AAA83086.1| 2616|Drosophila melanogaster serine protease protein. Length = 2616 Score = 27.5 bits (58), Expect = 3.8 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 294 KFIDLLNNIQNALIFITKIGQFISQFD-MFPFKNSLNAHTWNDIDSSFYS 148 KF D QN LI D M P N LN HTWN D+ S Sbjct: 617 KFEDQARPNQNELIDTFGTALDAKALDKMGPKINPLNGHTWNAADAQILS 666 >AE014296-1129|AAF50656.1| 2616|Drosophila melanogaster CG10129-PA protein. Length = 2616 Score = 27.5 bits (58), Expect = 3.8 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 294 KFIDLLNNIQNALIFITKIGQFISQFD-MFPFKNSLNAHTWNDIDSSFYS 148 KF D QN LI D M P N LN HTWN D+ S Sbjct: 617 KFEDQARPNQNELIDTFGTALDAKALDKMGPKINPLNGHTWNAADAQILS 666 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,293,796 Number of Sequences: 53049 Number of extensions: 209402 Number of successful extensions: 452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 631882260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -