BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11g01 (738 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25750| Best HMM Match : AFG1_ATPase (HMM E-Value=5.6e-12) 66 2e-11 SB_1911| Best HMM Match : AFG1_ATPase (HMM E-Value=1.8e-26) 33 0.32 SB_1836| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) 28 9.1 SB_1524| Best HMM Match : 7tm_6 (HMM E-Value=0.51) 28 9.1 >SB_25750| Best HMM Match : AFG1_ATPase (HMM E-Value=5.6e-12) Length = 424 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 621 GVYIWGSVGGGKTMLMDLFYDTVPIKEKLRVHFNSFML 734 G+Y++G VG GKT+LMD+FYDTVPIK K RVHF SFML Sbjct: 10 GLYLYGGVGSGKTILMDMFYDTVPIKSKRRVHFYSFML 47 >SB_1911| Best HMM Match : AFG1_ATPase (HMM E-Value=1.8e-26) Length = 392 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +3 Query: 411 VNDGPWQAYTQKVSSKALSKDPHQERVVQHLQKVYQ 518 + GP + Y + V S LS D HQ ++V+ LQ++++ Sbjct: 45 ITKGPLRDYDELVESGQLSIDKHQRQIVEKLQEIHK 80 >SB_1836| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) Length = 413 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 251 KLLCVSKRKKIDDNKQNVQTKFNLSCFHVFDASDEALQ*VY 373 K+ C RKK++++ + K + SC F+ SD+ L+ Y Sbjct: 210 KIYCT--RKKLEEHLKKFHKKCDCSCEEFFETSDDYLEHYY 248 >SB_1524| Best HMM Match : 7tm_6 (HMM E-Value=0.51) Length = 407 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = -2 Query: 521 LLIYFLQMLHYTFLMRIFA*CLAAHFLSVCLPRSIVYEVLCVS 393 L ++ +H++ L R+F A + ++V +++ V CVS Sbjct: 295 LAVFAFDAMHFSLLSRVFRGAPAGYIVTVLFMNFLIFLVPCVS 337 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,857,792 Number of Sequences: 59808 Number of extensions: 402388 Number of successful extensions: 963 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -