BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11f11 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 211 3e-55 SB_38639| Best HMM Match : Avirulence (HMM E-Value=1.5) 30 1.5 SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_8895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 8.3 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 211 bits (516), Expect = 3e-55 Identities = 101/164 (61%), Positives = 125/164 (76%) Frame = +3 Query: 159 EDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKE 338 +D K+P VPE++LK + L ++ K++EIFKRAE+YVKEYR KE Sbjct: 3 QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62 Query: 339 RDEIRLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPKVRKVLQLFRLRQINNGVFVRL 518 DE+R+ + A+ GN+YVP EA+LAFVIRIRGIN VSPKVRK+LQL RLRQINNGVFVRL Sbjct: 63 VDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKVRKILQLLRLRQINNGVFVRL 122 Query: 519 NKATVNMLRIAEPYIAWGYPNLKSVRELVYKRGFAKLSGQRIPI 650 NKAT NMLRI +PYIA+GYPNLKSVREL+YKRG+ K+ QR+ + Sbjct: 123 NKATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGKVDKQRVAL 166 >SB_38639| Best HMM Match : Avirulence (HMM E-Value=1.5) Length = 546 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 358 PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRRSV 462 P +HA T P + N H +S S +T RRSV Sbjct: 318 PFRHATTTITVLPSRYNNHTASSSHATTTIQRRSV 352 >SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -2 Query: 514 RTNTPLFIWRSLNSCRTLRTFGETWLIPRIRMTNANLASPGT**LPRLRACLASLISSRS 335 RT PLF L C R TW P + + + L + +A L+ +RS Sbjct: 295 RTRAPLFYSFLLTGCTARRRENVTW-FPSMALAGSILLKQRCSDMNTTACIMAVLVKTRS 353 Query: 334 LMRYSLTY--CSALLKIS 287 + ++ L + CS+ ++IS Sbjct: 354 MEQFLLLFIVCSSEIQIS 371 >SB_8895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -3 Query: 684 MEPLLNNAVGSELVYVVHSAWRIHVCILTHGHSLSWGIPKQCKARRYVAYS 532 ++PL N G + V R + CI++ +SWG + AR VA S Sbjct: 159 LDPLTNLCAGEPVADVFAVVARPNNCIISLADGVSWGTKSRLAARSAVAGS 209 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 261 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 386 R AI ++RE+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 261 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 386 R + ++REI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 333 KERDEIRLARQARNRGNYYVP 395 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 351 RLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPKVRK 464 RL R + R NYY+ + +AF + I + + P R+ Sbjct: 1886 RLRRTEKRRQNYYIATQKLMAFALNIYEVLKDDPLTRR 1923 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 571 PQAM*GSAIRSIFTVALFRRTNTPLFIWRSLNSCRTLRTFG 449 P+ + + + +++V+L R N LF RSL SC RT+G Sbjct: 428 PRVLCATLLPVVYSVSLDSRYNE-LFTGRSLQSCGNQRTWG 467 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,012,994 Number of Sequences: 59808 Number of extensions: 393072 Number of successful extensions: 942 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -