BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11f10 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 155 1e-39 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 9.8 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 155 bits (377), Expect = 1e-39 Identities = 69/81 (85%), Positives = 71/81 (87%), Gaps = 4/81 (4%) Frame = +1 Query: 46 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHLIDATTAAFKAG 225 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHLIDATTAA+KAG Sbjct: 1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHLIDATTAAYKAG 60 Query: 226 KIAQNPF----GNKGTAIPPP 276 KIA NPF +IPPP Sbjct: 61 KIAPNPFTAGPPKPNISIPPP 81 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.0 bits (47), Expect = 9.8 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 186 LCLFL-HPFLIIKLHIVFMFSSCAV-SFPYT 100 +CL L H LII+L + +++ CAV P+T Sbjct: 369 VCLPLAHAKLIIRLRLKVLYTMCAVKEAPHT 399 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,124 Number of Sequences: 2352 Number of extensions: 12960 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -