BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11f10 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.3 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 4.0 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 5.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.2 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 551 TDAELLCINLKTKC 592 +DAEL+C+ TKC Sbjct: 288 SDAELICVTTGTKC 301 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.6 bits (46), Expect = 4.0 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +1 Query: 103 VRKTHCTGRKHKDNVK 150 +R THC DN++ Sbjct: 409 IRNTHCVNNNQNDNIQ 424 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 198 CNNSGIQSRQNCSKSIWQQRHCNT 269 CN S S +C I QRH +T Sbjct: 374 CNISPRSSADSCQVGIMAQRHRDT 397 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 5.2 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 291 NGTRRTPTSCTRWSSRYDTSSIYGSWRSYGTTNDDGSTWANAANDGNETA 440 NG+ R+P S +R S + + I S+ S T N +T + ++T+ Sbjct: 320 NGSPRSPESNSRCSVKREKIKISVSYPSTETLNTKCNTLERTPSKCSQTS 369 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,831 Number of Sequences: 438 Number of extensions: 3470 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -