BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11f08 (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 27 0.091 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 27 0.091 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 27 0.12 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 23 2.6 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 3.4 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 7.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 7.9 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 27.5 bits (58), Expect = 0.091 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +2 Query: 338 DECSAICRVNEMPRL-KYASVVRVVVILGLFC 430 DEC+ CR E PR+ Y + + +LG C Sbjct: 106 DECARACREGEPPRICYYHFTLELYTVLGAAC 137 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 27.5 bits (58), Expect = 0.091 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +2 Query: 338 DECSAICRVNEMPRL-KYASVVRVVVILGLFC 430 DEC+ CR E PR+ Y + + +LG C Sbjct: 106 DECARACREGEPPRICYYHFTLELYTVLGAAC 137 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 27.1 bits (57), Expect = 0.12 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 299 QYSAICCPRKRN*DECSAICRVNEMPRLKYASVVRVVVILGLFCLW 436 Q+ AIC P+ + + NE+PR + V++ +G C+W Sbjct: 21 QFCAICVPKITSTN--------NEVPRWYICYTIGVIITIGCLCIW 58 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 22.6 bits (46), Expect = 2.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 383 KYASVVRVVVILGLFCLWLQIMLSASGGGMYRDGEELMNSNDTSE 517 K A + V+L W Q++ G+YR E+ + D SE Sbjct: 94 KQAGKILTFVLLNYRNEWNQLVAKYDPDGIYRKQYEIDDDYDYSE 138 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 421 ALLSVAADHAVCFW 462 AL+S D VC+W Sbjct: 17 ALVSATTDKVVCYW 30 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -2 Query: 329 VSADNRWRCTELWHLFN 279 VS D WR T W+ N Sbjct: 100 VSTDIAWRITVAWYAGN 116 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/48 (20%), Positives = 19/48 (39%) Frame = +2 Query: 404 VVVILGLFCLWLQIMLSASGGGMYRDGEELMNSNDTSEQVLALVPPEL 547 V ++ +F L + L GMYR ++ + ++P L Sbjct: 462 VFAVINVFSGELPVFLQEHRNGMYRPSIYFISKTLAESPIFIIIPVTL 509 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,603 Number of Sequences: 336 Number of extensions: 2658 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -