BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11f08 (597 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.02c |||Par A family ATPase iron cluster assembly protein... 28 1.2 SPAC3C7.09 |set8||lysine methyltransferase Set8 |Schizosaccharom... 26 4.8 SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy... 25 6.3 >SPAC806.02c |||Par A family ATPase iron cluster assembly protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 608 Score = 27.9 bits (59), Expect = 1.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 424 LLSVAADHAVCFWRGNV*GWRRADEFERHVGT 519 L+S + D+++CFWR + W + + H T Sbjct: 438 LVSGSYDNSICFWRDDGDDWALTCQLQGHTNT 469 >SPAC3C7.09 |set8||lysine methyltransferase Set8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 429 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 356 CRVNEMPRLKYASVVRVVVILGLFCLWLQI 445 C V ++P+L S R + IL +FCL Q+ Sbjct: 336 CSVEDLPKLVQLSPKRDLYILRVFCLAEQL 365 >SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 544 LGGDQG*HLFRRVV-RIHQLFSIPIHSP 464 + G QG H R IH LF++P +SP Sbjct: 741 ISGSQGLHYKRLTTDMIHNLFNVPSNSP 768 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,254,451 Number of Sequences: 5004 Number of extensions: 43304 Number of successful extensions: 119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -