BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11f03 (665 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0127 - 18401461-18401464,18401868-18403876,18404060-184042... 32 0.47 09_06_0303 - 22149214-22149474,22150099-22150236,22150856-221511... 31 0.82 09_06_0142 - 21107878-21109104 29 4.4 08_02_1258 - 25670092-25670152,25671124-25671327,25671400-256716... 29 4.4 08_02_0821 + 21545013-21545082,21545660-21545769,21546302-215463... 28 5.8 06_03_1457 - 30287185-30287287,30287691-30287759,30288212-302883... 28 5.8 06_01_0255 - 1900508-1900549,1900728-1900817,1900902-1900995,190... 28 5.8 01_06_0795 - 32051794-32053362,32053452-32053595,32054102-320549... 28 5.8 07_01_0072 - 525351-525494,526029-526256,526345-526458,527616-52... 28 7.7 03_06_0071 + 31465707-31466237,31467455-31468075,31468438-314685... 28 7.7 >01_05_0127 - 18401461-18401464,18401868-18403876,18404060-18404237, 18404381-18404958,18405609-18405611 Length = 923 Score = 31.9 bits (69), Expect = 0.47 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 360 HITYCLGIHTIFFCD 316 H+T CL +HT+FFCD Sbjct: 708 HVTRCLKMHTVFFCD 722 >09_06_0303 - 22149214-22149474,22150099-22150236,22150856-22151100, 22151344-22151809 Length = 369 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +1 Query: 379 ILHKYTQTYSTLVQDVRSVDLDKVLFEWFKSETQNGNTINEEQLQSKATNLEK 537 + ++ + Y++ QD+ S D+ K FE FK+ + N N+++ S L K Sbjct: 42 LYERWRRVYASSSQDLPSSDMMKSRFEAFKANARQVNEFNKKEGMSYTLGLNK 94 >09_06_0142 - 21107878-21109104 Length = 408 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 280 INALDNGQCKMEIAKKYGVNPQTISNMYR 366 I A D+G K+++ KYG NP + + R Sbjct: 161 IKAPDSGDAKVDLGLKYGANPDEVLPLLR 189 >08_02_1258 - 25670092-25670152,25671124-25671327,25671400-25671611, 25671701-25671749,25671833-25672612,25672696-25672767, 25672907-25672954,25673053-25673127,25673238-25673312, 25673614-25673668,25673931-25674016,25674759-25674988 Length = 648 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +1 Query: 355 NMYRKKEYILHKYTQTYSTLVQDVRSVDLDKVLFEWFKSETQNGNTINEEQLQSKATN 528 ++++ +++ +KY T +V + R +L + F + QNG+ L S ATN Sbjct: 167 DLHKNDDWLKNKYHPTNLEIVMESRRNELARTAANQFLQDLQNGSLDIGPGLTSSATN 224 >08_02_0821 + 21545013-21545082,21545660-21545769,21546302-21546376, 21546825-21546875 Length = 101 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 217 LMHIFPKKGYKKIGPLTKLQIINALDNGQCKMEI 318 L+H+ + GY K T + LDN KME+ Sbjct: 63 LIHVLEEAGYTKDSNFTLPDFMKILDNSDVKMEV 96 >06_03_1457 - 30287185-30287287,30287691-30287759,30288212-30288351, 30288447-30288641,30288743-30289363,30289688-30290257, 30290332-30293638,30293764-30293863,30293978-30295014, 30295256-30295604,30296299-30296374,30296456-30297022, 30297094-30297238,30298281-30298405,30298491-30298582, 30298646-30298828,30298946-30299058,30299499-30299649, 30299720-30299882 Length = 2701 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 340 DSHHIFLRFPSCIDHYLK 287 DS+ +F++FPS IDH +K Sbjct: 2225 DSNALFMQFPSLIDHLIK 2242 >06_01_0255 - 1900508-1900549,1900728-1900817,1900902-1900995, 1901119-1901315,1901838-1901957,1902559-1902654, 1902744-1902869,1903125-1903221,1904476-1904546, 1904629-1904724,1904803-1904955,1904993-1905136 Length = 441 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +1 Query: 301 QCKMEIAKKYGVNPQTISN--MYRKKEYILHKYTQTYSTLVQDVRSVDLDKVLFEWFKSE 474 QC+ I KK+ + P +N M K ++H++ TY + D+ +D K ++E K+ Sbjct: 48 QCR-SILKKFSIFPTAYNNFRMSAKIAPVIHEW--TYDAMCHDLLEMDGQKYIYEVSKAG 104 Query: 475 TQ 480 ++ Sbjct: 105 SE 106 >01_06_0795 - 32051794-32053362,32053452-32053595,32054102-32054965, 32055335-32055892 Length = 1044 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = -1 Query: 539 TFSRFVALLCNCSSFIVFPF*VSDLNHSKRTLSRSTERTSCTSVLYVCVYLC 384 T+ + A+ NC+ +V V+ LNH +R L RS ER + + + LC Sbjct: 546 TWEKLSAIRANCAIELVLDECVALLNHMRR-LKRSAERAAASQGHGPTIRLC 596 >07_01_0072 - 525351-525494,526029-526256,526345-526458,527616-527747, 529086-529265,529376-529507,529879-530055,530536-530718, 530894-530938,531192-531306,531770-532128,532700-532939 Length = 682 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 280 INALDNGQCKMEIAKKYGVNPQTISNMYRKKEYILHKYTQ 399 I + D + K E + G N + S + RKKE + KYTQ Sbjct: 463 IESKDPEKVKQEKERALGQNIRAHSILQRKKEKVSRKYTQ 502 >03_06_0071 + 31465707-31466237,31467455-31468075,31468438-31468520, 31468895-31468979 Length = 439 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/35 (31%), Positives = 24/35 (68%) Frame = +1 Query: 439 LDKVLFEWFKSETQNGNTINEEQLQSKATNLEKVR 543 LDK+L WF ++TQ+ ++ + +Q+K T++ ++ Sbjct: 300 LDKILKTWFSNKTQDSKSM--QFIQAKVTSIPLIK 332 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,824,124 Number of Sequences: 37544 Number of extensions: 273992 Number of successful extensions: 560 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -