BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e23 (241 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1677| Best HMM Match : WD40 (HMM E-Value=0.00074) 73 3e-14 SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18) 27 1.8 SB_38123| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 27 2.4 SB_19201| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_59270| Best HMM Match : RVT_1 (HMM E-Value=7.8e-06) 25 7.2 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 25 7.2 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 25 7.2 SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) 25 7.2 SB_12560| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 25 7.2 SB_15843| Best HMM Match : VWA (HMM E-Value=4.1e-35) 25 7.2 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 25 9.5 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) 25 9.5 SB_31644| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) 25 9.5 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 25 9.5 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 25 9.5 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 25 9.5 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_44111| Best HMM Match : OAD_gamma (HMM E-Value=4.4) 25 9.5 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) 25 9.5 SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) 25 9.5 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_31122| Best HMM Match : RVT_1 (HMM E-Value=0.0033) 25 9.5 SB_27648| Best HMM Match : Ribosomal_L18ae (HMM E-Value=2.8) 25 9.5 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 25 9.5 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 25 9.5 SB_15954| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 25 9.5 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 25 9.5 >SB_1677| Best HMM Match : WD40 (HMM E-Value=0.00074) Length = 1087 Score = 73.3 bits (172), Expect = 3e-14 Identities = 30/61 (49%), Positives = 45/61 (73%) Frame = +3 Query: 36 VMATGRIVVYGGRGALGAACVNHFKSFNYWVANIDLNPNEKADFNITVPKDASWVEQEDH 215 V++ R+++YGG+GALGA CV++FK+ +WVA++DL PNE+A N+ V SW EQ + Sbjct: 90 VVSGSRVLIYGGKGALGATCVSYFKAREWWVASVDLFPNEEAHANVIVDPAKSWDEQNNE 149 Query: 216 V 218 V Sbjct: 150 V 150 >SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 63 YGGRGALGAACVNHFKSFNYWVANIDLNPNEKADFNI 173 Y ALGAA + + W+A L+PN+ A+ +I Sbjct: 805 YDAMAALGAAGMVDVQKLAKWIAESHLDPNDPANADI 841 >SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18) Length = 659 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 154 KKPILTLLSPKT-LHGLNRKIM 216 KKP LL +T LHGLNRK++ Sbjct: 151 KKPKTALLDKRTSLHGLNRKVI 172 >SB_38123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 27.1 bits (57), Expect = 2.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 82 NAPRPPYTTILPVAITTSSLVHN 14 N P+PP P +IT+S HN Sbjct: 371 NTPKPPIELPTPASITSSQTAHN 393 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 167 KIGFFVGI-QINVSDPIIKRFKMVHAGSTQCPTTTV 63 ++G FV + Q+ DP++ F + H PTTT+ Sbjct: 75 RVGPFVRLKQVYTLDPLLPEFSITHITQAGYPTTTL 110 >SB_19201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 100 FTQAAPNAPRPPYTTILPV 44 FT A P PR P+T +LP+ Sbjct: 236 FTHALPLTPRIPFTHVLPL 254 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 100 FTQAAPNAPRPPYTTILPV 44 FT A P PR P+T LP+ Sbjct: 212 FTHALPLTPRIPFTLALPL 230 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 2336 LKKTKVMHLGSEIAPTVTIND 2356 >SB_59270| Best HMM Match : RVT_1 (HMM E-Value=7.8e-06) Length = 509 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +3 Query: 117 NYWVANIDL--NPNEKADFNITVPKDAS 194 ++WV+NID+ N + +IT+ DAS Sbjct: 350 DWWVSNIDISFNDTNRPPIDITIYSDAS 377 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 248 LKKTKVMHLGSEIAPTLTIND 268 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 456 LKKTKVMHLGSEIAPTLTIND 476 >SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) Length = 3404 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 128 DPIIKRFKMVHAGSTQCPTTTVHDDSTG 45 DPI F+ + CP T +HD+ TG Sbjct: 2889 DPI--HFRSILCDDETCPYTEMHDNKTG 2914 >SB_12560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +3 Query: 117 NYWVANIDL--NPNEKADFNITVPKDAS 194 ++WV+NID+ N + +IT+ DAS Sbjct: 151 DWWVSNIDISFNDTNRPPIDITIYSDAS 178 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 128 LKKTKVMHLGSEIAPTLTIND 148 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 111 SFNYWVANIDLNPNEKADFNITVPKDASWVEQEDHVVNELGNA 239 +F+Y V + +K DFN P + +E+ +++V E G++ Sbjct: 825 TFHYSVILYGSSSVKKFDFNTAFPYREALIEESNNLVKENGSS 867 >SB_15843| Best HMM Match : VWA (HMM E-Value=4.1e-35) Length = 1686 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 111 SFNYWVANIDLNPNEKADFNITVPKDASWVEQEDHVVNELGNA 239 +F+Y V + +K DFN P + +E+ +++V E G++ Sbjct: 567 TFHYSVILYGSSSVKKFDFNTAFPYREALIEESNNLVKENGSS 609 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 108 LKKTKVMHLGSEIAPTFTIND 128 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 416 LKKTKVMHLGSEIAPTFTIND 436 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 494 LKKTKVMHLGSEIAPTFTIND 514 >SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) Length = 308 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 178 LKKTKVMHLGSEIAPTFTIND 198 >SB_31644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 935 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 174 TVPKDASWVEQEDHVVNELGN 236 T P+DA + DHVV EL N Sbjct: 896 TEPRDADCIRMYDHVVFELVN 916 >SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) Length = 385 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 211 LKKTKVMHLGSEIAPTFTIND 231 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 24 LKKTKVMHLGSEIAPTFTIND 44 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 410 LKKTKVMHLGSEIAPTFTIND 430 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 245 LKKTKVMHLGSEIAPTFTIND 265 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_44111| Best HMM Match : OAD_gamma (HMM E-Value=4.4) Length = 305 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 118 LKDLKWFTQAAPNAPRPPYTTI 53 L +L W APN PRP T+ Sbjct: 80 LMNLHWRESRAPNHPRPDLNTL 101 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 538 LKKTKVMHLGSEIAPTFTIND 558 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 77 LKKTKVMHLGSEIAPTFTIND 97 >SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) Length = 352 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 301 LKKTKVMHLGSEIAPTFTIND 321 >SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) Length = 175 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 120 YWVANIDLNPNEKADFNITVPKDASWVEQE-DHVVNE 227 YW+ ++D DF + + WV+ DH +NE Sbjct: 89 YWILSVDSIDVVNMDFTVDLFLRQEWVDPRLDHGLNE 125 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_31122| Best HMM Match : RVT_1 (HMM E-Value=0.0033) Length = 324 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 273 LKKTKVMHLGSEIAPTFTIND 293 >SB_27648| Best HMM Match : Ribosomal_L18ae (HMM E-Value=2.8) Length = 796 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 118 LKDLKWFTQAAPNAPRPPYTTI 53 L +L W APN PRP T+ Sbjct: 398 LMNLHWRESRAPNHPRPDLNTL 419 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 60 LKKTKVMHLGSEIAPTFTIND 80 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 134 LKKTKVMHLGSEIAPTFTIND 154 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 77 LKKTKVMHLGSEIAPTFTIND 97 >SB_15954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 118 LKDLKWFTQAAPNAPRPPYTTI 53 L +L W APN PRP T+ Sbjct: 44 LMNLHWRESRAPNHPRPDLNTL 65 >SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) Length = 889 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 812 LKKTKVMHLGSEIAPTFTIND 832 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 25 LKKTKVMHLGSEIAPTFTIND 45 >SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) Length = 717 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 119 IKRFKMVHAGSTQCPTTTVHD 57 +K+ K++H GS PT T++D Sbjct: 600 LKKTKVMHLGSEIAPTFTIND 620 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,304,250 Number of Sequences: 59808 Number of extensions: 114890 Number of successful extensions: 435 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 16,821,457 effective HSP length: 57 effective length of database: 13,412,401 effective search space used: 295072822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -