BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e22 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14710.1 68415.m01654 F-box family protein contains Pfam prof... 31 0.80 At5g28160.1 68418.m03403 kelch repeat-containing F-box family pr... 29 1.9 At3g63200.1 68416.m07100 patatin-related low similarity to patat... 29 3.2 At2g35210.2 68415.m04318 human Rev interacting-like family prote... 28 5.7 At2g35210.1 68415.m04319 human Rev interacting-like family prote... 28 5.7 >At2g14710.1 68415.m01654 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 362 Score = 30.7 bits (66), Expect = 0.80 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +3 Query: 318 DKMNVKHHSPVYSVIMKLKKEVDINH--GDSVVWKNIEMASGPNSP 449 D+ ++ V I E INH GD VVWKN S PN P Sbjct: 236 DRFSLLKQCMVTKKIEVFVTENKINHENGDDVVWKNFMTFSSPNLP 281 >At5g28160.1 68418.m03403 kelch repeat-containing F-box family protein low similarity to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 324 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 318 DKMNVKHHSPVYSVIMKLKKEVDINHGDSVVWKNIEMA 431 DK+++ H ++ ++ L+K HG VW NIE A Sbjct: 271 DKVDLSHDKDIWCAVIALEKR----HGSDEVWGNIEWA 304 >At3g63200.1 68416.m07100 patatin-related low similarity to patatin-like latex protein allergen Hev b 7 - Hevea brasiliensis, EMBL:AF113546; contains patatin domain PF01734 Length = 384 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +2 Query: 11 CWQHEDYIRI---AVSDAGAEHLLQHLHDETTQSG 106 CW DY+RI ++ GAE LL+ ET G Sbjct: 305 CWNRTDYVRIQANGLTSGGAEELLKERGVETAPFG 339 >At2g35210.2 68415.m04318 human Rev interacting-like family protein / hRIP family protein similar to ARFGAP1 protein GI:7211442 from [Homo sapiens]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 371 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 549 SVVEGIFLCIVSEMIPRLLGSHRKYPQYLALSEPAS*GRRPFLYSSKRR 403 SV GIFLCI + R LG H + + L +S + +Y R Sbjct: 37 SVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNR 85 >At2g35210.1 68415.m04319 human Rev interacting-like family protein / hRIP family protein similar to ARFGAP1 protein GI:7211442 from [Homo sapiens]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 395 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 549 SVVEGIFLCIVSEMIPRLLGSHRKYPQYLALSEPAS*GRRPFLYSSKRR 403 SV GIFLCI + R LG H + + L +S + +Y R Sbjct: 37 SVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNR 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,983,573 Number of Sequences: 28952 Number of extensions: 186310 Number of successful extensions: 567 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -