BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e17 (555 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 29 0.077 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.31 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 2.2 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 5.1 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 5.1 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 29.5 bits (63), Expect = 0.077 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 154 LTRLSRHCWNSKPNTRLPPDKI 219 +++L R CW+ PN RLP +I Sbjct: 413 MSKLMRECWHMNPNVRLPALRI 434 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 27.5 bits (58), Expect = 0.31 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +1 Query: 127 KRLRPKNRKLTRLSRHCWNSKPNTRLPPDKIGSQDPRLQQWPPPHRPMTSPLSIVTSPRR 306 +++ P R R S P+ R PP + S+ R W P RP + P + PRR Sbjct: 248 RKIPPSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTRPTSW-PRSRPTSKPKRL---PRR 303 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 205 PPDKIGSQDPRLQQWPPPHRP 267 PP G Q P + PPP RP Sbjct: 248 PPSAQGMQRPPMMGQPPPIRP 268 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.4 bits (48), Expect = 5.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 142 KNRKLTRLSRHCWNS 186 KNRK R++RH W++ Sbjct: 203 KNRKSRRVTRHNWSA 217 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.4 bits (48), Expect = 5.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 142 KNRKLTRLSRHCWNS 186 KNRK R++RH W++ Sbjct: 204 KNRKSRRVTRHNWSA 218 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 371,379 Number of Sequences: 2352 Number of extensions: 5240 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -