BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e17 (555 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 4.8 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 4.8 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 8.4 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 4.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 172 HCWNSKPNTRLPPDKIGSQDPRLQQWPPP 258 HC N P P I Q PR + PP Sbjct: 351 HCGNFPPRPMGPWISIQEQVPRFRYIGPP 379 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 4.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 166 SRHCWNSKPNTRLPPDKIGSQDPRLQQWPPPHRPMTSPLSIVTSPRR 306 +++C ++ + R KIGS P + P R + SP++ RR Sbjct: 642 NQNCLDASSSRR--GSKIGSPTPAESTFIPEERRIYSPITFQDVARR 686 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 220 GSQDPRLQQWPPPHRPMTSPLSIVTS 297 G + +Q PPP+R +S++TS Sbjct: 481 GRIENTIQGLPPPYRLNKPLMSLITS 506 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,929 Number of Sequences: 438 Number of extensions: 1889 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -