BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e16 (663 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 26 0.24 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 26 0.24 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 6.8 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 6.8 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 26.2 bits (55), Expect = 0.24 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -1 Query: 366 SEKLLLCQTMSPNSFERRTKILILHPEYLFFSPCVMS 256 S + +CQT+S + +R +L++ YL+F V+S Sbjct: 194 SYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIVIS 230 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 26.2 bits (55), Expect = 0.24 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -1 Query: 366 SEKLLLCQTMSPNSFERRTKILILHPEYLFFSPCVMS 256 S + +CQT+S + +R +L++ YL+F V+S Sbjct: 120 SYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIVIS 156 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 231 PELEDRSVWTLHKGKKRGTQDEVSIFLFDVQKN 329 PE +R + + T+ EV +FL ++KN Sbjct: 342 PEFRERLLNVNLSAVDQKTRQEVHMFLMAIEKN 374 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 231 PELEDRSVWTLHKGKKRGTQDEVSIFLFDVQKN 329 PE +R + + T+ EV +FL ++KN Sbjct: 342 PEFRERLLNVNLSAVDQKTRQEVHMFLMAIEKN 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,781 Number of Sequences: 336 Number of extensions: 3257 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -