BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e13 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 295 8e-82 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 295 bits (724), Expect = 8e-82 Identities = 131/164 (79%), Positives = 151/164 (92%) Frame = +2 Query: 149 KPPYKIADEKLAEWGRKEIMLAEKEMPGLMACRRKYAPAKILKGARIAGSLHMTVQTAVL 328 KP YK+AD LAE+GRKEI+LAE EMPGLMACR+KY P KIL+GARIAG LHMT+QTAVL Sbjct: 3 KPAYKVADISLAEFGRKEIVLAENEMPGLMACRQKYGPLKILRGARIAGCLHMTIQTAVL 62 Query: 329 IETLIELGAEVQWSSSNIYSTQDEAAAALVAVGIPIYAWKGETDDEYIWCIEQTLIFPDG 508 IETLIELGAEVQWSS NI+STQD AAAA+V G+P+YAWKGETD+EY+WCI QTLIFPDG Sbjct: 63 IETLIELGAEVQWSSCNIFSTQDHAAAAMVKAGVPVYAWKGETDEEYMWCIRQTLIFPDG 122 Query: 509 KPLNMILDDGGDLTNLVHTKYPDLLKDVKGITEETTTGVHNLYK 640 KPLNMILDDGGDLTNLVH ++P+LLK+++G++EETTTGVHNLYK Sbjct: 123 KPLNMILDDGGDLTNLVHAEHPELLKEIRGLSEETTTGVHNLYK 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,941 Number of Sequences: 2352 Number of extensions: 14669 Number of successful extensions: 30 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -